Wa Btec Locomotive Product Catalog

68

Transcript of Wa Btec Locomotive Product Catalog

Page 1: Wa Btec Locomotive Product Catalog
Page 2: Wa Btec Locomotive Product Catalog
Page 3: Wa Btec Locomotive Product Catalog

1

Locomotive Illustration Page 2 Low Emissions Locomotives Page 3 Telemetry Systems Page 5 • HeadofTrain Brake Systems Page 7 • FastBrake®ElectronicAirBrake• CabHandleUnit• Miscellaneous Pneumatics Page 11 • BallValves• Vaporid®AirDryer• Compressors• Miscellaneous Monitoring Page 23• FuelMonitors• VideoTrax™DigitalRecorderSystem• EventRecorders• CentralDiagnosticSystem• Miscellaneous ECP Braking Page 29 Positive Train Control Page 33 • I-ETMS®• PTCComponents• TMDS® Friction Products Page 39

Truck Components Page 41• Wheels• Springs• TractionMotors• BrushHolders• AxleGenerators Cab Components Page 45• LocomotiveCab• LocomotiveCabRadio• LavatoryandSanitarySystemProducts• Miscellaneous Heat Exchangers Page 51• Jacket-WaterRadiators• Miscellaneous Rubber Products Page 55 Services Page 57• Education• PTCSupport• Compressors• TractionMotors• LocomotiveService• Pneumatics• Electronics Company Listing Back Cover

Table of Contents

Page 4: Wa Btec Locomotive Product Catalog

2

Braking System1. Telemetry System2. Fast Brake3. Fast Brake Control Handles4. Emergency Brake Valve5. Slack Adjustor

Pneumatics6. Ball Valve7. Angle Cock8. Brake Cylinder9. Compressor10. Air Dryer11. Vent Valve

Monitoring12. Digital Pressure Panel13. Fuel Monitor14. VideoTrax Recorder15. VideoTrax Camera16. Event Recorder

ECP17. SCD Power Supply18. VCD Power Supply19. ID Module20. Head End Unit

PTC21. Cut Out Switch22. EMTS Display23. Cut Out Cabinet24. Commlink25. Navigation Sensor26. Train Management Computer

Miscellaneous27. Cab Radio28. Lavatory29. Ice Box30. Weather Stripping31. Wheels32. Springs33. Head Gasket34. Axle Generator35. Brake Shoe36. Control System37. Traction Motor38. Traction Motor Brush Holder

Heat Exchangers39. Air Cooler40. Radiators

Locomotive

2021

22

23

27

28

2930

26

12

15

16

171819

2

5

1

3

4

6

7

837

38

910

13

14

31

34

35

3639

40

32

33

24

25

11

Page 5: Wa Btec Locomotive Product Catalog

3

Page 6: Wa Btec Locomotive Product Catalog

Feature MP21B Multi-Engine MP20B Single Engine MP20C Single EngineHorsepower 2,100 bhp (700 bhp x 3) 2,000 thp 2,000 thpEngine Cummins Qsk-19

(Tier 3 nonroad)Mtu-Detroit Diesel

12v4000 (or equivalent) Mtu-Detroit Diesel

12v4000 (or equivalent)Traction Motors D77 / D78 D77 / D78 D77 / D78Maximum Speed (nominal) 50 mph 70 mph 70 mphContinuous Tractive Effort 55,000 lbs 55,000 lbs 82,000 lbsStarting Tractive Effort 85,000 lbs 85,000 lbs 128,000 lbsWeight (nominal) 270,000 lbs 277,000 lbs 390,000 lbsLength 59’ 2” 59’ 2” 68’ 2”Height Plate C / Plate L Plate C / Plate L Plate C / Plate LFuel Capacity 2,500 gal 2,500 gal 3,900 galAlternators 1800 rpm constant speed Kato 350 KVA variable speed Kato 350 KVA variable speedAir Compressor Electric driven rotary screw WLN WLNDynamic Brake Optional Optional Optional Locomotive Control Q-Tron QES III microprocessor Q-Tron QES III microprocessor Q-Tron QES III microprocessor

*1,400 bhp model (Mp14b) coming soon

*Tier 2 Mpxpress commuter locomotive also available

MP21B Ultra Low Emissions Multi-Engine Locomotive • 35%ormorefuelsavingsdependingondutycycle• 80-90%lessNOx;70-80%lessPM• Tier3nonroademissionslevels• Modulardesignformobilemaintenance• Pressurizedenginecompartment• Hightractiveeffort;improvedadhesion• Integratedautostart/stop;lessidling• Redundantsystemsforimprovedreliability

Low Emissions Locomotives

Business Unit: MotivePowerAs an industry leader in the design, manufacture and remanufacture of diesel – electric locomotives, MotivePower has delivered over 2,500 locomotives to customers since 1972.

Switchers

4

Page 7: Wa Btec Locomotive Product Catalog

5

Page 8: Wa Btec Locomotive Product Catalog

Business Unit: Wabtec Railway ElectronicsTheTrainLink™IIEndofTraintelemetrysystemperformsthreemajorfunctions:monitoringmanyessentiallastcar conditions, providing rear of train emergency braking capability, and providing a high visibility marker for nighttime use.

TheTrainLink™IIsystemiscomprisedofaHeadofTrainUnit,locatedinthelocomotiveandanEndofTrain,located on the last car.

The End of Train sends the Head of Train the following Information (via a unique RF Radio link):

• LastCarBrakePipePressure• MotionStatus• MarkerLightStatus(OnorOff)• BatteryLife• RFCommunicationStatus• EmergencyValveStatus

The Head of Train relays this information the operator of the train. It also allows the operator to check communication status and initiate emergency braking.

Telemetry Systems Head of Train

Integrated• Controlledthroughthelocomotivecomputerandislocatedinthe equipment rack in the short hood of the locomotive

Standalone• Self-containedunitthatislocatedonthecontrolstandinthe locomotive cab

• Columbia,SC • KansasCity,MO

• Montreal,QC,Canada • SanLuisPotosi,Mexico

Reconditioning Service Available in:

6

Page 9: Wa Btec Locomotive Product Catalog

7

Page 10: Wa Btec Locomotive Product Catalog

8

Features / Benefits:• FastBrake®hasbeendevelopedtoincludeadvanceddiagnosticstoproviderailroadpersonnelwithstep-by-step

troubleshooting capabilities and recommended actions• FastBrake®canbeintegratedwithDistributedPower(DP)andElectronically-ControlledPneumatic(ECP)braking

applications•FastBrake®designconfigurationscansupportbothonepipeortwopipelocomotivepneumaticinterconnection

as well as single or dual cab control• Designedforsuperiorreliabilityincludingtightlyintegratedelectronicsandpneumatics,redundantelectronics,

dual channel power supply, and reduced part count• Enhancedmaintainabilityincludingfewerreplaceablemodules,advanceddiagnosticsandtroubleshooting

capabilities as well as integrated fault retrieval• Distributedprocessingamongportions• OEMintegratedorseparatedisplays• Industrystandardcommunication-controllerAreaNetwork(CAN)• Serviceproven,corepneumatictechnologyfrom26LandEPIC®• Easilyaccessiblepneumatictestpoints•Pneumaticbackup

POU Specifications:• PneumaticOperatingUnit(POU)• Size:36inWx23inHx23inD,weight295lbs.• PrimaryReplaceableModules:4• SupplyVoltage:Nominal74or110VDC• PowerUsage:1Amp@Nominal74VDC

Business Unit: Wabtec Railway Electronics Wabtec’sFastBrake®ElectronicAirBrakeisamicroprocessor-basedelectro-pneumaticbrakingsystemprovidingmeansforcontrolofthetrainairbrakesinlocomotiveapplications.FastBrake®ismadeupoftwomajorcomponents: the Pneumatic Operating Unit (POU) and the Handle Controller Unit (HCU).

Brake SystemsFastBrake® Electronic Air Brake

• Columbia,SC • KansasCity,MO

• Montreal,QC,Canada

Reconditioning Service Available in:

The POU Consists of Four Major Portions• BrakePipeControlPortion(BP)• BrakeCylinderControlPortion(BCP)• IndependentApplicationandReleasePortion(IAR)• PowerSupplyPortion

Page 11: Wa Btec Locomotive Product Catalog

9

Desktop “30” Style • Magnetoresistive,non-contactingpositionsensortechnology• Desktoporsidemounthandleoptionscompatiblewithalldesignconfigurations

Standalone “26” Style with Display • Magnetoresistive,non-contactingpositionsensortechnology• Desktoporsidemounthandleoptionscompatiblewithalldesignconfigurations

Business Unit: Wabtec Railway Electronics Wabtec’s braking systems use of state-of-the-art microcomputer technology. It provides the logic for electro-pneumatic operators to control the compressed air generated from the locomotive main reservoirs. The equipment includes an electronic cab control unit, available in the desk-style and standalone consoles shown here. A micro-computer is programmed to issue and interpret commands from both the cab controller and pneumatic control units. The pneumatic interface unit and optional cab display unit are designed to provide feedback information to the engineer during equipment operation. The enhanced diagnostics built into the unit greatly reduce locomotive downtime during testing and troubleshooting.

FastBrake® Cab Handle Unit

Brake Systems

Reconditioning Service Available in:

• Columbia,SC • KansasCity,MO

• Montreal,QC,Canada

Page 12: Wa Btec Locomotive Product Catalog

Emergency Brake Valve • Largecapacityforfastventingofbrakepipetoinitiateemergencyquick

action• Availablewithintegralmicroswitchfordirectinterfacingwithelectronic

air brake equipment, event recorders and other safety related devices• Handleavailablefromthefactorypre-assembledineitherleftorrighthandconfigurations;alsofieldchangeable

26 C Brake Valve • Providesairbrakecontrolofthelocomotiveandthetrain – Controls brake pipe pressure to activate the control valves on each car and locomotive in the train to apply or release train brakes – Usually assembled with the Independent Brake Valve to provide better train control

30 A-CDW Brake Valve • Desktopmountedairbrakecontrolofthelocomotiveandthetrainin conjunction with 30-CW module – Controls brake pipe pressure to activate the control valves on each car and locomotive in the train to apply or release train brakes – Usually assembled with the Independent Brake Valve to provide better train control

Business Unit: WABCO Locomotive Products Wabtec offers Emergency Brake Valves and Slack Adjusters for locomotive braking systems.

Brake SystemsBrake Valves

10

Page 13: Wa Btec Locomotive Product Catalog

11

Page 14: Wa Btec Locomotive Product Catalog

12

• 200WOG• AvailablewithTorLPorts• Availablew/standardorlockinghandle• Canbemanufacturedwithvariouspipethreads

3 – WAY

• 400WOG• Availablewithstandardorlockinghandle• Availablewithwireties• Ventedornon-vented

2 – WAY

• 200WOG• Valvesoperatetogetherwithonehandlemotion• Canbebothopenoroneopenandoneclosed

Dual Valve

Pneumatics

Business Unit: WABCO Locomotive ProductsWabtecoffersover2000typesofballvalveconfigurationsincluding2way,3way,anddualvalves.

Ball Valves

Features & Benefits• ForgedbrassvalveslastlongerandperformbetterduetoWabtec’sinnovativevalvedesign• AllvalvesareavailablewithTeflonorBunasealsdependingonthematerialflowingthroughthevalve• Mostsizesareavailableinfullorstandardportsizes• Replacementkitsareavailableforvalves• Specialconfigurationscanbeproducedbasedonneedandusage

Page 15: Wa Btec Locomotive Product Catalog

13

Business Unit: WABCO Locomotive ProductsVAPORID®providesthemostconvenient,costeffectiveandreliablemethodofremovingcontaminants.

PneumaticsVaporid® Air Dryer

Features & Benefits• Providesaneffective,reliablemethodtoremovewater,oil,aerosols,andlinedebrisfromtrain-lineair• Clean,dryairisessentialtoachievelonglifeforairbrakesystemsandallrelatedpneumaticequipmenton

locomotives and cars• Twintowerdesignprovidescontinuousdrying• Borosilicatecoalescingfilterreducesdebrisandoilaerosols(thatcanclogthedesiccant)forincreaseddryerlife• Pre-measuredeasy-changedesiccantbagsmeanlessdowntime• Pottedsealedsolidstateelectronicsareweatherresistantforreliableoperation• ElectronicsControlPackageisequippedwithamemoryfunction,allowingthedryertooperatewhenthe

compressor is loaded thereby conserving air• Electricaloptionsinclude24,37.5,74,and110VDC,withothervoltagesavailable• Humidityindicatorsarelocatedonbothtowerstoensurethateachisfunctioningproperly• Thermostaticallycontrolledhighpowerheatersfordrainandpurgevalvesarestandardequipmenttoguardagainstfreeze-ups

• Maxflowrateof236SCFMwithadjustmentsforspecificflowratesavailable• Compactsize:24”Hx13.75”,Wx15.5”D• Lightweight:92.5lbs.

• CarsonCity,NV • Chicago,IL

• KansasCity,MO • Montreal,QC,Canada

Reconditioning Service Available in:

Page 16: Wa Btec Locomotive Product Catalog

14

Features & Benefits• Pulleyshaftormotordrive• Singleordualspeedmotordrive• Variousmotorvoltagesavailable• Stainlesssteelbraidedunloadertubing• Ratedforcontinuousorstart/stopoperation• Standaloneorpalletized• 1100RPMratedspeed;140psiratedpressure• Displacementatratedspeed:247.5CFM• 60HPatratedspeedandpressure

3 Cylinder Air Cooled Compressor (3CD™)

Pneumatics

Business Unit: WABCO Locomotive Products Offering a complete line of air-cooled, water-cooled, and rotary compressors, Wabtec provides original equipment and can rebuild main line reciprocating compressors.

Compressors

Page 17: Wa Btec Locomotive Product Catalog

15

PneumaticsCompressors (continued)

Integral Aftercooler• Efficient,costeffective,maintenance-freewaytoprecipitatemoisture

from compressed air braking systems• Reducestheneedforcoolingpipingortubingbetweenthedischargeandthefirstmainreservoir

3CD™ Compressor Upgrades

• Designedformotordrivencompressorsthatoperatestart/stop• Eliminateswatercondensateinoilbymaintainingastableintercooler

temperature

Thermostatically Controlled Intercooler (TCIS™)

• Ventsintercoolerpressureinunder2seconds• Preventsmotorstallsbyremovingairloadwhenstarting• Eliminatesmanualintercoolerdrainingprocedure• 75wattheatertoprotectagainstfreeze-ups

Rapid Unloader

• Simplifieddesign• Highercoolingefficiency• Virtuallyindestructible

One Piece Molded Fan

Page 18: Wa Btec Locomotive Product Catalog

16

PneumaticsCompressors (continued)

2CD™

Features & Benefits• TemperatureManagementSystem(TMS)tocontrolinternaltemperature• Pulley,shaft,ormotordrive• Integralcoolingfans• Highefficiencyinletfilter• Oilsightgage/Oilpressureindicator• Ratedforcontinuousorstart/stopoperation• Ratedspeed:1000RPM• Ratedpressure:140psi• Displacementatratedspeed:153.5CFM• 40HPatratedspeedandpressure

Page 19: Wa Btec Locomotive Product Catalog

17

Features & Benefits: • Combinationcompressorexhauster:

– 2 or 3 compression cylinders– 2, 3 or 4 exhauster cylinders

• Oilsightgauge• Oilpressureindicator• Optionaloilcoolerkit• Ratedforcontinuousoperation

PneumaticsCompressors (continued)

6 Cylinder/4 Cylinder Air Cooled Compressor Exhauster

6CD3UC™ 6CD4UC™ 4CD2UC™

Rated Speed: 1050 RPM 1050 RPM 1050 RPM

Rated Pressure: 140 psi 140 psi 140 psi

Rated Vacuum: 28 inHg 28 inHg 28 inHg

Displacement at rated speed: — — —

- Compression: 323 CFM 161 CFM 161 CFM

- Vacuum: 484 CFM 645 CFM 323 CFM

HP at Rated Speed, Pressure and Vacuum: 120 105 65

Page 20: Wa Btec Locomotive Product Catalog

18

PneumaticsCompressors (continued)

3 Cylinder Water Cooled Compressor

Features & Benefits• DirectlyinterchangeablewithWLN/WBOtypecompressors• Variouscrankshaftcenterlineheightsavailable• Availableaseithershaftormotordrive• Oilsightgageordipstickavailable• Doublepassandplatestyleintercooleravailable• Wabtecsafetyvalveandbreather• Ratedforcontinuousorstart/stopoperation• Ratedspeed:1050RPM• Ratedpressure:140psi• Displacementatratedspeed296CFM• 68HPatratedspeedandpressure

3CW™ 3CWD™

Page 21: Wa Btec Locomotive Product Catalog

19

Features & Benefits: • Compactunit• Variousmotorvoltages• Spin-onoilfilterandseparatorcartridge• Hightemperatureprotection• Start/stoporcontinuousoperation• Encapsulatedairend• Highefficiencyinletfilter• Combinationoil/aftercooler

PneumaticsCompressors (continued)

Rotary Screw Air Cooled Compressor

WRS-100™ WRS-160™

Rated Pressure: 145 psi 145 psi

Maximum Air Delivery Range: 70-120 CFM 120-175 CFM

Maximum Horsepower Range: 22-40 HP 35-60 HP

Page 22: Wa Btec Locomotive Product Catalog

20

26-F Control Valve • Respondstochangesinbrakepipepressuretoprovidealocomotive brake application on one locomotive• Includesaquickreleasevalvetoprovideactuateorbail-offoftrainbrakes

A-1 Charging Cut-off Pilot Valve• Respondstoatrainbreak-in-twooremergencybrakefromthe locomotive to initiate: – Brake pipe charging cut-off – Automatic Sanding – Power Cut-off – Dynamic Cut-off

H-5 Relayair Valve • Apneumatic,doublepiloted,threewayvalvethatchangestheair passages through it when air pressure of a predetermined amount or more is in the control chamber• Usedinvariouswaysincludingtocontrolalargeflowofairpiloted byasmallamountofcontrolair,aninterlocktocontrolflowofairin one circuit by placing its control in another independent air circuit, as a sequence valve for timing, cycling, etc.• NotinterchangeablewithanHBRelayairValve

Pneumatics

Business Unit: WABCO Locomotive ProductsWabtec manufactures pneumatic brake components and related devices.

Miscellaneous

Page 23: Wa Btec Locomotive Product Catalog

21

26-F Control Valve • Respondstochangesinbrakepipepressuretoprovidealocomotive brake application on one locomotive• Includesaquickreleasevalvetoprovideactuateorbail-offoftrainbrakes

A-1 Charging Cut-off Pilot Valve• Respondstoatrainbreak-in-twooremergencybrakefromthe locomotive to initiate: – Brake pipe charging cut-off – Automatic Sanding – Power Cut-off – Dynamic Cut-off

H-5 Relayair Valve • Apneumatic,doublepiloted,threewayvalvethatchangestheair passages through it when air pressure of a predetermined amount or more is in the control chamber• Usedinvariouswaysincludingtocontrolalargeflowofairpiloted byasmallamountofcontrolair,aninterlocktocontrolflowofairin one circuit by placing its control in another independent air circuit, as a sequence valve for timing, cycling, etc.• NotinterchangeablewithanHBRelayairValve

PneumaticsMiscellaneous (continued)

P-2-A Brake Application Valve • Safetydevicethatcausesapenaltyfullservicebrakeapplication when initiated by over speed control or safety control systems

J-1 Relay Valve• Receivesasignalfromthecontrolvalveorindependentbrakevalveto allow main reservoir air to the brake cylinders to provide a brake application

Brake Handle• Removablebrakehandlefor26typebrakevalves

24-A Double Check Valve • Allowsairflowfromoneoftwoseparatesourcestoacommonpoint of use without either of the two sources being connected to each other

Page 24: Wa Btec Locomotive Product Catalog

• Enhancedventingcapacityresultsinincreasedemergencytransmissionspeeds at lower brake pipe pressures

• Selfpurgingexhaustvalveandimprovedcorrosionresistantdesignpromotes more reliable operation long term

VX Vent Valve

• Designedforapplicationtotheendsofthebrakepipeoneachcar• Providesameansforclosingthebrakepipeasontheendofthelastcar

of a train and for the attachment of the brake pipe hose which permits the brake pipe to be connected between coupled cars

• Thehandleisdesignedtolockinbothopenandclosedpositions

Angle Cock

• Furnishedtosuitthespaceandleveragerequirementsoflocomotives,these cylinders differ from freight car brake cylinders primarily in the wide variety of diameters available and shorter piston strokes

• Thepushrodispinnedtothepistonhollowrodforpositivereleaseoftheshoe from the wheel when the piston retracts

• NorthAmericanstandardfordiesel-electriclocomotives• Widevarietyofsizesandpushrodconfigurationsavailabletosuitvaried

application requirements

Brake Cylinders

PneumaticsMiscellaneous (continued)

22

Page 25: Wa Btec Locomotive Product Catalog

23

Page 26: Wa Btec Locomotive Product Catalog

24

• Utilizessolid-stateelectronicsandadvancedpneumaticstodeterminelocomotive fuel levels

• Accurateto+/-onepercent• Providesautomaticfueltankconfigurationwhileaddingdynamictag

capabilities for the transfer of fuel level and other useful management information to wayside readers for collection

• Internaldiagnosticsanduseofthe“bubblemethod”forcalculatingthefuel level increase the reliability and accuracy of the system

• Fuellevelcanbeintegratedintolocomotivebuilders’displays,and stand-alonedisplaysareavailableforinternal/externalmounting

FuelLink

Eliminate the maintenance cost of your traditional bubbler system by switching to Wabtec Global Services ultrasonic fuel measurement solution!

• WabtecGlobalServicesnowoffersalowcostturnkeysolutiontoconvertyour bubbler fuel measuring system to an ultrasonic fuel measuring system

• ThroughWabtecGlobalServices’ultrasonicfuelmeasuringsystemwhichdoes not require air, you can eliminate airline and fuel contamination maintenance costs

• Weprovideasmallandunobtrusiveunitthatintegratesdirectlyintotheexisting wiring of your Wabtec fuel monitoring system

• Wabtec’splug&playcapabilityallowsourultrasonicfuelmeasuringsystem to be mounted upon multiple styles of locomotives

• Unlikeothersystems,WGS’directlyintegrateswithWabtec’sfuelmonitoringsystem,withnoneedtochangebackofficesystems

• WabtecGlobalServicesultrasonicfuelmeasurementsensorisconstructed of stainless steel making it rugged and weather resistant

• 2yearwarranty• Builtinfaultdetectionfunctiontoidentifyinaccuratereadings• Providesmoreaccuratefuelreadingsthantraditionalbubblersystems

Ultrasonic Fuel Monitor

Business Unit: Wabtec Railway Electronics & Wabtec Global Services Wabtec offers locomotive fuel monitoring systems.

MonitoringFuel Monitors

• Columbia,SC • KansasCity,MO

Reconditioning Service Available in:

Page 27: Wa Btec Locomotive Product Catalog

25

Business Unit: Wabtec Railway Electronics The VideoTrax™ Digital Video Recorder system provides digital video and audio information for accident investigations.

MonitoringVideoTrax™ Digital Recorder System

Features & Benefits: • IntegrateswithexistingWabtecSolidStateEventRecordersforacompletepictureonboardthelocomotive• Easy-to-usedataanalysisandplaybacktools• GPSsupportforlocationandtimesynchronization• Ethernetcommunicationsforremoteaccessandconfiguration• Supportsuptofourcameras• Multipleaudiooptions• Multipleharddriveconfigurationoptions• SupportsNTSCandPALstandards• Completeinstallationandsupportservices

• KansasCity,MO

Reconditioning Service Available in:

Page 28: Wa Btec Locomotive Product Catalog

26

PTC Event Recorder - TTX - REC – ETMS • MultipledatastreamrecordingcapabilityiscompatiblewithexistingRS-

422 locomotive communication channels for FRA Event Recorder logging. Single point download and common message timestamp

• FRACrashhardenedmemory• 8GB/16GB,(DOTcertifiedto-FRA49CFRPart229)• LSI5MCUrackmountcompatible• CompliantwithS-9101BV1.0DraftAppendixB• FullyintegratedwithWabtecI-ETMS®system• EthernetportfordirectconnectiontoWabtecI-ETMS®systemortoon

board locomotive network • DownloadviaEthernetconnection(direct,PTCwirelesscommunications,

locomotive network)• DownloadviaHigh-SpeedUSBport(cardreaderreplacement)• PTCEnhancedDataAnalysisSoftware(DAS-3)providesuserswithanintegratedsolutionfordisplayingcriticalPTCdata,I-ETMS®data,locomotive FRA data, train location on map, and video recording

• TTX-REC-IDRcompatibilityforEVOapplications• TTX-REC-PCMcompatibilityforPCM-0Xreplacement• TTX-REC-CHMcompatibilityforCHM-0Xreplacement• TTX-REC-M5andM6compatibilityviaLegacyLinkcable• Bach-Simpson53000/54000compatibilityviaLegacyLinkcable• Q-TronDatacord5000/6000compatibilityviaLegacyLinkcable• WabtecECPbrakeeventrecording• SynchronizationoutputcompatiblewithWabtecVideotrax™• QESSystemrecordingviaEthernet

• BuildsuponWabtecRailwayElectronicstrustedsuiteofdataanalysistoolstoprovideamethodofdecompressing,processing,andanalyzingdatadownloaded from supported solid state event recorders

• Itdisplaysdatain‘timeline’basedgraphsandtables,andallowsuserstoquickly scan for events of interest

• DASIIIhasallthefeaturesofpreviousversions,reorganizedandpresentedinanefficientandintuitivelayout

Data Analysis Program III (DAS III)

Business Unit: Wabtec Railway Electronics Wabtec offers a variety of event recorders with a range of capabilities, from basic FRA-compliant units to enhanced models with integrated alertness control, expanded events, integrated air and modular PC board designs.

MonitoringEvent Recorders

• Columbia,SC

Reconditioning Service Available in:

Page 29: Wa Btec Locomotive Product Catalog

27

Monitoring

Business Unit: MotivePowerMonitorlocomotivelocation,healthstatusandmanagefleetdiagnosticsinreal-timewiththeMotivePowerCentralDiagnosticsSystem(MPXCDS).Meetingtheneedsforfleetsofallsizes,theCDSsystemcanhelpimproveon-time performance, reduce operating costs and increase revenue through improved productivity, enhanced asset tracking, proactive service management and comprehensive preventative maintenance information.

Central Diagnostics System

Features / Benefits: • Remotemonitoringofvehiclehealth – CDS integrates with the Q-Tron locomotive control system,

Head End Power (HEP) genset (where applicable) and Cab Signal system

–Captures80%oflocomotivefunctions – System provides faults real-time to the MPXCDS web site – Over 200 messages available from control system alone•Intuitivewebsitedisplayofcriticalparameterssuchas: – Prime Mover and HEP operating values such as real time

horse-power, fuel consumption, operating temperatures, and more.

– Battery Current (Amps) – Locomotive Speed (MPH) – HEP kW load vs. Time – Trainline monitoring of critical MU (multi-unit) signals – AESS status•GPSlocationtrackingforeachlocomotive•Onsitetechniciansavailabletooffersupport•CDSsystemtoutilizecellularcommunicationor802.11wireless•Secure&reliableCDSdatastorage•Emailnotificationtokeyoperationspersonnel•Easytousewebinterface – Basic diagnostic instructions included for both maintainer and operating engineer – Access individual locomotive schematics and manuals online through the CDS interface•Locomotiveproven,rugged,expandableCDShardware•Abilitytoaccessportabletestequipmentfilesremotely•AllCDShardware,provisionsandlaborincluded•CombinesMotivePowerserviceexpertiseandtheCDSsystem•Improveson-timeperformance

Page 30: Wa Btec Locomotive Product Catalog

28

Monitoring

Business Unit: Wabtec Railway Electronics, Wabtec Global Services Wabtec offers a variety of locomotive monitoring systems.

Miscellaneous

LocoTemp Fan Controller System• LocoTemp(fancontroller),Power/InterfaceCable,TemperatureProbe• Wabtecsupportsnewbuildsandrepairs

RM-160 Monitoring System• BasicsystemincludesRM-160modem,160MHzradio,DC/DCPower converter(either12VDC/12VDCor24VDC/12VDC),CommunicationCables• WabtecsupportsRM-160fornewbuilds,narrowbandupgrades,andrepairs

ICE Equipment• OfferingtheRockwellTrainPowerSupply• WabtecsupportsICEequipmentrepairs

Digital Pressure Panel • Lowcost,easytoinstalldigitalduplexgaugewithexpansioncapabilities• Portsintheback,allowingquickandeasycalibrationcheckswithout

removing the pressure display from the locomotive• Easytoreadvaluesformainreservoir,equalizingreservoir,brakepipeand

brake cylinder• Lowpowerconsumptionandtheabilitytomeasurepressurerangesfrom

0-200 psi with a resolution of 1psi• 100%compatiblewithexistingcontrolconsoles,providingyouthelowest

possible entry cost• Longercalibrationintervalsovertraditionalanalogdisplayswhichcanreduceannualservicingmanhoursbyover50%

• Displaysuseback-litLCDtechnologytoprovideahighcontrastindicationin all lighting conditions, from bright sun light to night-time viewing

• Theretro-fitapplicationispoweredbya74VDCviaaterminalblockonthe back of the panel

Page 31: Wa Btec Locomotive Product Catalog

29

Page 32: Wa Btec Locomotive Product Catalog

30

• HEU/LCMApplicationSoftware• MultipleLSIInterfacesforcommunicationstoindustrystandard

locomotive systems• Ethernetinterfaceforconnectiontodataloggersandotherlocomotive

systems• 2x4-20mAinputsforexternalsensors• Discrete74VDCI/Oforexternalcontrol/monitoring• FrequencyInputforAxleSpeedSensors

ECP Interface Unit

Business Unit: Wabtec Railway Electronics The Wabtec ECP System is an Electronically Controlled Pneumatic Braking System for freight trains that is compliant withtheAARS4200industrystandards.ThecompleteECPsystemincludeslocomotivecomponents,car/wagoncomponents and an ECP-EOT.

ECP BrakingMiscellaneous

Network Interface Unit (NIU-II)

The EIU directly interfaces with the ECP 230 VDC Trainline power supply. The EIU is directly connected to the NIU-II and also acts as a gateway betweentheNIU-IIandTrainlineNetworktoallowHEU/LCMmessagestobe passed between the Trainline network devices and the NIU-II. NOTE: The previous Locomotive ID (LID) functionality is now integrated into the cable between the EIU and NIU-II. This cable has an integrated static memory for maintainingtheLocomotiveStaticparametersspecifictoeachcustomerapplication.

• InterfacesdirectlytotheTrainlinePowerSupplyandNIU-II• Discrete74VDCI/O• PCSRelay(NO&NCoperation)• PowerSupplyControllerLogic• ECPTrainlineInterfaceforNIU-II

• Montreal,QC,Canada

Reconditioning Service Available in:

Page 33: Wa Btec Locomotive Product Catalog

31

The junction boxes are installed on the front and back of each ECP locomotive. The J-Box allows the locomotive to be connected to an adjacentlocomotiveorcar/wagon.ThejunctionboxalsoprovidesaHeadEnd Termination (HET) Plug to terminate the Trainline.

• Locatedatendoflocomotive• BIWendsillconnectorsprotectcar/locomotivepermanentwiring

ECP Interface Unit

ECP BrakingMiscellaneous (continued)

The 230VDC Trainline Power Supply converts the Locomotive Battery Voltage to the 230 VDC power required to operate the ECP devices. The power supply also provides the 24VDC output used for sequencing ECP compliant cars and locomotives.

• InterfacesdirectlytothelocomotiveinverteroutputandEIU• 74VDCto230VDCconversionfortrainlinepower• 24VDCforsequencingcarsandlocomotives• Overcurrentprotection• Trainlinepolaritymatching

230VDC Trainline Power Supply

Junction Box

• Columbia,SC • KansasCity,MO

Reconditioning Service Available in:

Page 34: Wa Btec Locomotive Product Catalog

32

ECP BrakingMiscellaneous (continued)

Cab Display Unit TheCDUisaproprietarygraphicalinterfacetoanECP/WDPsystem. The interface communicates directly with the NIU-II and is used as a MMI betweentheuserandtheECP/WDPSystem.

• ConnectstotheNIU-IIandCDU• Graphicalcolordisplay• Softkeystoreceiveuserinput• Audiblealarmoutput

• Columbia,SC • KansasCity,MO

Reconditioning Service Available in:

Page 35: Wa Btec Locomotive Product Catalog

33

Page 36: Wa Btec Locomotive Product Catalog

34

Business Unit: Wabtec Railway Electronics Wabtec Railway Electronics designs and manufactures electronic and electro-pneumatic train control systems for the railway industry.

Positive Train ControlInteroperatable Electronic Train Management System – I-ETMS®

Features / Benefits: • Integratesnewtechnologywithexistingtraincontrolandoperatingsystemstoenhancetrainoperation

and safety• Preventstrackauthorityviolations,speedlimitviolations,unauthorizedentryintoworkzones,andtrain

movement through a switch left in the wrong position, all of which reduce the potential for train accidents• WithI-ETMS®,thecrewremainsincontrolofthetrain.Thesystemmonitorsandensuresthecrew’scompliancewithalloperatinginstructions,whiletheI-ETMS®displayscreenprovidesthetraincrewawealthofoperatinginformation

• Asthetrainmovesdownthetrack,theI-ETMS®on-boardcomputer,withtheaidofanon-boardgeographicdatabase and global positioning system, continuously calculates warning and braking curves based on all relevant train and track information including speed, location, movement authority, speed restrictions, work zones,andconsistrestrictions

• I-ETMS®alsocommunicateswithwaysidedevicescheckingforbrokenrails,properswitchalignmentandsignalaspects

• Allinformationiscombinedandanalyzedinrealtimetoprovidea“safety-net”forimprovedtrainoperation

Page 37: Wa Btec Locomotive Product Catalog

35

Positive Train ControlInteroperatable Electronic Train Management System – I-ETMS®

I-ETMS® System Architecture

Page 38: Wa Btec Locomotive Product Catalog

36

Train Management Computer• EnforcesMovementAuthorities,SpeedLimits,HandThrowSwitch

Alignment• TriplexTrainControlCPU’sforSafetyandHighAvailability• MeetsSubpartIRequirementsforPositiveTrainControlSystems• HostsEnergyManagementApplicationCPU• HostsITCMessageRouter(ITCM)CPU

Positive Train ControlPTC ComponentsBusiness Unit: Wabtec Railway Electronics Wabtec offers various PTC components for use with their Interoperatable Electronic Train Management System, I-ETMS®.

I-ETMS® Display• DisplaysTrainLocation,TrackFeatures,Restrictions,WorkZones• EnhancesSituationalAwareness• CrewEntryofCredentials• DualDisplaysAvailabletoSupportAdditionalCrewwithDutiesinCab

Commlink IIWabtec’s Communication Manager, Commlink II, provides IP routing and communication management functions.• Hostforadditionalapplicationssuchas:

– ITC application gateway – Event recorder download – Video recorder health – Fuel reporting – Health monitoring

• Card-filearchitectureprovidesflexibility – Mobile access router – General purpose computer

• Fullyqualifiedforlocomotiveenvironment• SharedcomponentswithI-ETMS®TMCsimplifieslogisticsmanagement• Coresystemcomprisedofprocessormodule,router/switchmodule

(RSM), cellular modems, and GPS receiver

Page 39: Wa Btec Locomotive Product Catalog

37

Positive Train ControlPTC Components (continued)

• ConvenientmountingforTMCinretrofitapplicationsCut-Out Cabinet

• CutoutI-ETMS®frompenaltybrake,emergencybrakeandhorn•Tamper-evidentseals

Asy Cut-Out Switch

• GPSReceiver• ProvidesWAAS-correctedpositionfortrainlocation• Tworeceiverspersystemforhighavailability

Navigation Sensor Module

• Columbia,SC

Reconditioning Service Available in:

Page 40: Wa Btec Locomotive Product Catalog

38

• Standardtrainmanagementfunctionsincluding:– Track bulletin system– Train sheet system– Track&time/tracktags– Autorouting/movementplanning– SCADA control– Backofficesystemsinterface– Mobile device interfaces– Third party and custom interfaces– Track editor– Playback and simulation tools

• TMDS®utilizescommercial-off-the-shelf(“COTS”)hardwareandsoftwarethat create a system that is straightforward and simple to operate and maintain

• TMDS®isscalablefromonetoover100dispatchers

Positive Train ControlTrain Management Dispatch System - TMDS® Business Unit: Wabtec Railway Electronics TMDS®isafully-integrated,bilingualtraincontrolsolutionforallmethodsofoperation,includingCTC,TWC,DTC,and PTC.

TMDS®

Back Office Server • Interfacetodispatchsystem• High-availability,fault-tolerant,scalableplatform• Supportssoftwareandtracksdatabaseupdates(mobiledevicemanager)• Supportstraininitializationprocessandinteroperabilitytransitions• Maintainsdownloadedon-boardsystemlogs• Communicationserver–dataradionetwork(s)• OtherMISSystems

Page 41: Wa Btec Locomotive Product Catalog

39

Page 42: Wa Btec Locomotive Product Catalog

40

Business Unit: Railroad Friction Products Corporation RailroadFrictionProductsmanufacturesCOBRA®high-frictionandlow-frictioncompositionbrakeshoes,specialty shoes, and disc brake linings for freight, locomotive, and transit vehicles.

Friction ProductsBrake Shoes

TreadGuard® Developed by Railroad Friction Products Corporation to address the problem of wheel removals due to shelling, spalling, and high impacts, TreadGuard®isavalue-addedbrakeshoewithacastironinsertthatprovidesthefollowingbenefitsforawiderangeoffreightcarandlocomotive applications:

• Castironinsertscontinuallycleanminortreaddefects&damage • Minimizesremovalofwheelsforrepair • Prolongslifecycleofwheels • Reduceswheelsetinventoryandchangeouts • Minimizesimpactsbetweenwheelandrail • PaintedREDforimmediateidentification • Reduceswheelsetturnings,outofservicetimeandhighimpact frequencies • MaterialsthatmeetAARindustrystandardRP-599

Standard Composition & Standard Flanged Composition

• Fulllineoffrictionmaterialsforlocomotiveapplications • MaterialsthatmeetAARindustrystandardRP-599 • Configurationstomeetavarietyoflocomotiveapplications –Fullwidth,APdesign,offsetdesignandflanged –14”,16”,18”lengths

Low-Friction • Noconversioncosts–LowFrictionLocomotiveBrakeShoesarea direct replacement for cast iron brake shoes • LongerWheelLife–Insertconditionsthetreadandremovesminor damage to wheels • Lighterinweightthancastironbrakeshoes • ColorcodedtoindicatetheyareLowFrictionBrakeShoes • Paintedyellowandshippedinyellowcontainers

Page 43: Wa Btec Locomotive Product Catalog

41

Page 44: Wa Btec Locomotive Product Catalog

42

Business Unit: Standard Car Truck, Barber Spring, Swiger Coil Systems, Fulmer Company, MotivePower Wabtec offers a variety of locomotive truck components.

Miscellaneous

Truck Components

OneSteel MicroAlloy Wheels• Forgedwheel• Rimquenchandtemper• Microalloyedwithvanadium• Improvedwearresistance• Improvedresistancetothermaldamage• Twogrades“MicroC”and“MicroB”– “MicroC”usedforfreightcars– 40–60%wearreductionandzerofailures

• Mobilewheeltruingserviceoffered

• Wabtecusescomputercontrolledcoilers• Springcapabilitiesincludebardiametersfrom1⁄2”to4”,outerdiameterto24”,andfreelengthsto72

• Loadtestingtocustomerspecifications• Nondestructiontestingonsite• Powdercoatandcustomcolorsdoneinhouse• Shot-peeningandendsurfacegrindingavailableuponrequest• Offeringhotwoundcompressionsprings

Powder Coated Springs

Page 45: Wa Btec Locomotive Product Catalog

43

Miscellaneous (continued)

Truck Components

Brush Holders

• With75+yearsinservice,FulmerCompanyoffersacomprehensiveproduct offering: Brush holder assemblies for traction motors, generators, alternators, and auxiliary DC equipment found on Electro-Motive Diesel and General Electric locomotives

• ReplacementOEMbrushholderparts,availablefromstock,includinginsulated studs, spring cells, springs, levers, bushings and other components

• FulmerCompany’sextensivepartsinventoryandcaptivefoundryenablethem to provide exceptional customer service

• FulmerCompanyprovidesapplicationsengineeringandtechnicalexpertise to create or improve designs

• ISO9001:2008certified

• Export,PA

Reconditioning Service Available in:

Traction Motors• AC/DCtractionmotorremanufacturing – D77, D78, D87, others• Tractionmotorcomponents• Coilproductsandservices• Remanufacturedunitsareequivalenttoobtaininganewmotor

directly from the OEM – Unit exchange programs available

• Cleveland,OH

Reconditioning Service Available in:

Page 46: Wa Btec Locomotive Product Catalog

44

Miscellaneous (continued)

Truck Components

Axle Generators

Dual/SingleOutput• Convertstherotationofthelocomotiveaxleintoapairof120pulses per revolution electrical signals Single Output• Convertstherotationofthelocomotiveaxleintoa60pulses per revolution electrical signals Reconditioning Service Available in: • Columbia,SC• KansasCity,MO

Page 47: Wa Btec Locomotive Product Catalog

45

Page 48: Wa Btec Locomotive Product Catalog

46

Business Unit: MotivePower Offering design and fabrication of all locomotive structures including cab, car bodies and frames

Features / Benefits:• Maximizethevalueofcapitalexpendituresthroughalocomotivecabreplacement• Extendlocomotivelifewhileincreasingefficiencyandproductivity• MotivePower’sOEMengineeringexpertiseandfocusonquality• Flexibledesigns• Plugandplaymethodology• Enhancedlocomotiveperformance• Abilitytomaintainproperemissionslevels• Facilitycapability

Locomotive Cabs

Cab Components

• Boise,ID • Chicago,IL • Houston,TX

Reconditioning Service Available in:

Page 49: Wa Btec Locomotive Product Catalog

47

Business Unit: Wabtec Global ServicesWabtecoffersanarrowband(12.5KHz)andultranarrowband(6.25KHz)AARcompliantLocomotiveCabRadio.

Cab ComponentsLocomotive Cab Radios

Locomotive Cab Radio, Tri-Mode• MeetsFCCandAARrequirementsforwideandnarrowbandchannels• Meetsfuturerequirementsforultranarrowband(6.25KHz)usingNXDNTM

standard• Drop-inreplacementforexistingAARcleancabradios,willfitinstandard

AAR clean cab radio rack • NewWabtecproprietarydesignedpartswithsamelookandfeelas

existing clean cab radios• Backlitbuttonscanbeoperatedwithglovedhands• TestedtoAARStandardS5702• 512availablechannels• Bright40characterdisplaywithcustomizabletextlabelsforhomechannel

names• DTMFandsingletonecontrols• Dispatchchannelcontrol• Squelchcontrol• Manual/autodimmingfeature• Stunfeatureforover-the-airdisablingofradiotransmitter

Portable Locomotive Cab Radio, Tri-Mode• MeetsFCCandAARrequirementsforwideandnarrowbandchannels• Meetsfuturerequirementsforultranarrowband(6.25KHz)usingNXDNTM

standard• Pre-programmedwithARRchannelplan• NewWabtecproprietarydesignedpowersupplyforlocomotivevoltage

operation• Microphonehandsetincluded• 512availablechannels• Backlit14characterdisplaywithcustomizabletextlabelsforhome

channel names• CapableoftransmittingDTMFandsingletone• Dispatchchannelcontrol• Squelchcontrol• Stunfeatureforover-the-airdisablingofradiotransmitter• Optionallyprogrammedchannelpairsuponrequest

• KansasCity,MO

Reconditioning Service Available in:

Page 50: Wa Btec Locomotive Product Catalog

48

Business Unit: MicrophorMicrophorofferssanitationsystemstotherailindustryincludingcostefficientrecirculatingretentiontoiletsfor freight locomotives. Built to withstand rugged conditions, Microphor’s robust retention toilets offers easeofmaintenanceandfitsintightlocomotivecompartments.

Lavatory and Sanitary System Products

Cab Components

RC900 & RC920 Toilet• Corrosion-freepolyethyleneinnertank• Exclusivecompositeinnertankminimizesanyinteractionwithhuman

waste during periodic servicing• Heavydutyfilterscreenremainsintankduringservicing• Recessedheavydutytankdrainslidevalve• Excellentbowlrinseanddurablepumphandle• Universalmountingforinstallation• Lidassemblyisinterchangeablewithcompatibletoilets

Lavatory Module• Completewater&wastesystemsolutionwithinalavatoryenclosure

for easy integration in the locomotive cab.• LavatoryenclosureismadefromFRPmaterialcompliantwithFRA

regulations• Turnkeysolutionforyourwaterandwasteinalocomotivecab.• Easyintegrationintothelocomotivecab.• Clearinterfacepointsminimizesyourwaterwasteintegration

engineering hours

Biological Treatment System• Wastetreatmentsystems • Biologicalsystem • Nodailypumpingrequired

Reconditioning Service Available in:

• Chicago,IL • SanLuisPotosi,Mexico

Microphor also offers a variety of waste treatment system maintenance products.

Page 51: Wa Btec Locomotive Product Catalog

49

Business Unit: MicrophorMicrophor manufactures ice boxes for locomotive use as well as ditch light controllers and accessories.

Cab ComponentsMiscellaneous

Icebox• Throughfloordraintopreventpuddles• Stainlesssteelinteriorsforeasymaintenance• Heavydutyhingesfordependableoperation• Closedcellspongerubberdoorsealsforbetterperformance• Boltstofloorforgreatstability• Designedspecificallyforrailroadapplications

Ditch-Master™ II Ditch Light Controller• MeetsFRAspecifications-Flashesatarateofoncepersecond witha50%dutycycle

• PolarityProtected–Notdamagedbyinputvoltagereversal• ShortCircuitProtection–Abletowithstandadirectshortcircuitacross

lamp terminals or wiring• TransientVoltageProtection–Filteringandtransientprotectionfrom

spikes and noise on the power lines• EasyInstallation–Rearmountingbracketandcompactpackageprovidegreatermountingflexibility

• RuggedDesign—Stateofthearttechnologyandtransientpowerprotection on all inputs will withstand typical railroad conditions for a extended service life

Microphor also offers a variety of waste treatment system maintenance products.

Page 52: Wa Btec Locomotive Product Catalog

5050

Cab ComponentsMiscellaneous (continued)

Slow-Closing Faucet• Heavynickelchromeplatedbrass,nonadjustable• Mounting-deckorwall• WaterFlow-53gpm,@50PSI• Reliablesimplebalancedvalvedesign• Efficientrosespraypattern• Designreducescleaningrequirementsandwaterusage

Page 53: Wa Btec Locomotive Product Catalog

51

Page 54: Wa Btec Locomotive Product Catalog

52

Heat Exchangers

Business Unit: Young Touchstone YoungTouchstone’sFlat-Round®MechanicalBondRadiatorcoresareyourbestchoiceforlongservicelifeandeliminatingdowntime.YoungTouchstonebeginsconstructionwithheavycopperfinswhichresist damage and maintain consistent heat transfer. Flat, heavy wall, seamless brass tubes are used for provenreliability.Tubesaresolderedtothefinstoprovidemaximumperformance.Thetubeendsaremechanically brought to a perfectly round shape then bonded to a heavy duty steel header plate with YoungTouchstone’sMechanicalBondprocess.YoungTouchstone’suniquebolted,deflectionfreesiderailswith patented expansion joints are added for strength and rigidity.

Jacket–Water Radiators

Replacement Cores are available as:• SingleLength6Row—PartNumber01788 ReplacesEMD—PartNumbers3129131,8206685,8490482,92526642• DoubleLength6Row—PartNumber02190 ReplacesEMD—PartNumbers9504784,9583760,40017115• TripleLength6Row—PartNumber02192 ReplacesEMD—PartNumbers3010256,3027016,3036850,8356205,8462344,8366731,8389388,9315655• AlsoAvailablein8Rowand4RowConfigurations

Features/Benefits:• Builttolastthelifeofthelocomotive• Tubesaremechanicallybondedintoheaders• Heavydutyfinconstruction,10finsperinch• Precisiontooledheaders• Uniquebolteddeflectionfreesideexpansionjoint

Reconditioning Service Available in:

• CarsonCity,NV•Columbia,SC•KansasCity,MO

Page 55: Wa Btec Locomotive Product Catalog

53

Heat Exchangers

Mechanical Bond Aftercooler Core• Improvedsideframedesigneliminatesweldcracksandimproves airflowthroughthecoreforgreatercoolingefficiency

• Mechanicallybonded1/2”thicksteelheaderjoint• Coppertubesforbetterheattransfer• Tubesmechanicallyexpandedintoaluminumorcopper finsforsuperiorheattransfer

Miscellaneous

Business Unit: Young Touchstone Wabtec manufactures heat exchange products for the railway industry.

Mechanical Bond Lube-Oil Cooler• Boxstyles• Mechanicallybonded½”thicksteelheaderjoint• Coppertubesforbetterheattransfer• Tubesmechanicallyexpandedintoaluminumfinsforsuperiorbond,

heat transfer performance and header joint strength compared to metallurgical bonds

• ReplacementoilcoolercoresexceedOEMstandardsandareinterchangeablewithoriginalequipmentoilcoolercoresonGP/SD18, GP/SD20,GP/SD24,GP/SD28,GP/SD30,GP/SD35,GP/SD38,GP/SD39, GP/SD40,GP/SD45,GP/SD50,andGP/SD60locomotives

FuelOilPre-Heater • ReplacesEMD9517269• Shell&tubestyles• Brasstubes,headers,shellandendhubs• Castironendbonnets• Brassbaffles• Steelmountingbrackets• Non-asbestosnitrilerubbercellulosefiber

• CarsonCity,NV•Columbia,SC•KansasCity,MO

Reconditioning Service Available in:

Page 56: Wa Btec Locomotive Product Catalog

54

Heat Exchangers Miscellaneous (continued)

Business Unit: Triangle Engineered Products TriangleEngineeredProductsspecializesinthemanufactureandremanufactureoflocomotivewaterpumps.

Water Pumps• Newwaterpumps • ReplacementcomponentsforEMDpumpapplications.• Remanufacturedwaterpumpsthatfeaturecomputerbalancedshaftand

impeller assemblies

• Bensenville,IL

Reconditioning Service Available in:

54

Page 57: Wa Btec Locomotive Product Catalog

55

Page 58: Wa Btec Locomotive Product Catalog

56

Business Unit: Wabtec Rubber Products and DuroxWabtecspecializesinproducingcustom-moldedrubberproductsinstandardorcustomizedcompounds,includingEPDM, Fluroelastomer, BUNA N, and Chloroprene.

Rubber ProductsMiscellaneous

Gaskets & Seals• EconomicalOEMreplacementgasketsandsealsforEMD,GE,&Alco

engines • PremiumOEMenhancementscutfromproprietarymaterialssuchas

Swellex™,whichswellstoacontrolledmaximum30%ofitsoriginalthicknesstoeliminateleakpathsandDurogard™sealstoeliminateproblems associated with cracked and hardened traditional sealing products

• AlsoofferingtheVectorOilRetentionSystemtodeflectoilbacktotheoil sump, inhibiting deck cover leaks

Weather Stripping• Forcabwindows,doors,andnumberboards• Preventsmoistureandairfromenteringthelocomotive• MadefromEPDMmaterialforlong-termuse• Afullrangeofin-linesectionsforbodypanelthickness1⁄16”to3⁄4”,glassthickness1⁄16”to3⁄4”

• Afullrangeofoff-linesectionsforbodypanelthickness1⁄16”to1⁄4”,glassthickness3⁄16”to9⁄16”

• Selflockandseparatelockapplications

Rubber Parts Kits• 26Lequipment• NC-391locomotivedraftgear

Also offering magnetic signage and non-conductive cable cleats

Page 59: Wa Btec Locomotive Product Catalog

57

Page 60: Wa Btec Locomotive Product Catalog

58

PTC Training and Qualification Program for PTC SystemsDesignedasatrainingandqualificationprogramforPTCsystemssubjectto FRA Rule, 49PART236 sub part I, Wabtec’s training program educates students on PTC systems to enable them to provide superior product support and install on-board PTC equipment to ensure successful railroad operations.

• Classcurriculumincludestheuseofanin-classvirtualPTCenvironment simulator and will provide trainees the knowledge to: – Safely install, replace, or repair each of the on-board PTC

components – Safely install, replace, or repair the interconnecting wiring for each

PTC component – Load operating software to critical PTC components – ConfigurationforPTCoperation – Validation testing of the PTC and related locomotive systems – Adhere to SAE standards: Producing quality, reliability, and

repeatability – Troubleshoot, diagnose, repair, and test all related aspects of the

onboard PTC equipment – Rapidly identify potential technical PTC system discrepancies that

may pose an operational safety issue

Business Unit: Wabtec Global Services Wabtec offers comprehensive training seminars and material geared toward educating rail personnel on the operation and maintenance of rail equipment.

ServicesEducation

Thisclassisdesignedforalocomotivemechanic/machinistbutitisadaptable to anyone working on locomotive brake equipment. Class topics include basic locomotive brakes, the history of air brakes and key in on the 26 type brake equipment. In this class participants will learn how to read air brake diagrams, what the various components do and how they work together. By understanding the components students are better equipped to troubleshoot the 26L or 30ACDW brake equipment. Class dates are published at www.wabtecglobalservices.com

Locomotive Air Brake Training

Books and Training MaterialsWabtec offers a wide variety of material geared toward educating rail personnel on the operation and maintenance of rail air brake equipment. Obtain a training catalog at www.wabtecglobalservices.com for a complete listing of publications.

Page 61: Wa Btec Locomotive Product Catalog

59

Business Unit: Wabtec Global Services and Xorail Wabtec offers a variety of PTC support services to assist customers with their PTC implementation.

ServicesPTC Support

PTC Equipment Installation and Testing• Turn-keyinstallationservicesbyWabtectrainedandcertifiedPTCinstallationtechniciansandvalidationtesting to ensure successful on-board system installationPTC Integration• Xorail’sapproachtototalsystemsintegrationconsistsofthepreliminaryfieldsurvey,designandverification, testingandinstallation,datamanagementsystemsdesignandverification,totalcommunicationandoffice controlsystems,locomotiveonboardsystemsandfinalin-servicecommissioningField Support• PTCcertifiedfieldservicetechniciansdedicatedtocustomerinstallationprogramsandon-boardsystem commissioning as well as long term support for post-commissioning operationsSoftware Maintenance• Tomaintainconsistencyoftheonboarddesign,performance,availabilityandreliability,WGSwillprovide software maintenance which includes management of third party software upgrade and licenses, support, software patches and system enhancement services as releasedHelp Desk• 24/7phonesupporttoaddressfieldrelatedproblems,assistintroubleshootingfieldrepair,anddispatchoffield service resources Spares • SparepartsinventoryandpoolstockmanagementRepair• OfferingmultipleservicelocationsforrepairandreturnofonboardPTCequipment,byqualifiedWabtectechniciansWayside Solutions• Wabtecoffersavarietyofwaysidesolutions,includingpreliminarysurveysandengineering,digitalcircuit design, application software design, simulation and rack testing, strategic sourcing, bungalow wiring, factory acceptance testing, logistic material and data management, construction installation, in-service commissioning, and data application software and plan management

Page 62: Wa Btec Locomotive Product Catalog

60

Business Unit: Wabtec Global Services, Triangle, WABCO Locomotive ProductsCombining a long history of compressor remanufacturing from Triangle Engineered Products, the design and development experience of OEM compressor manufacturing through WABCO Locomotive Products and the North American network of Wabtec Global Services’ repair centers, Wabtec offers comprehensive compressor solutions for the rail industry. Wabtec offers a complete line of air-cooled, water-cooled, and rotary compressors for OE application as well as remanufacturing services for the aftermarket.

Services

Features / Benefits: • Onecontactforallyourcompressorneeds• ISO9001-2008andAARM-1003certified• OEMdesignanddevelopmentproductknowledge

– Custom packages for unique applications– Motor and direct drive compressors in both air and water-cooled

technology– Complete rotary air generation packages

Remanufacturing Capabilities: • In-housecylinderandshaftremanufacture• In-houseMagna-fluxcapability• Accesstodevelopmentupgrades• Internalaccesstoawidevarietyofreplacementcomponents• Coremanagementservices• NorthAmericannetworkofservicelocations

Reconditioning Services — Compressors

• CarsonCity,NV• Columbia,SC

• SanLuisPotosi,Mexico• Wilmerding,PA

• Bensenville,IL

Reconditioning Service Available in:

Page 63: Wa Btec Locomotive Product Catalog

61

ServicesRemanufacturing Services — Traction Motors

Business Unit: Swiger Coil Systems and Fulmer CompanyWabtecremanufacturestractionandblowermotorstotheOEMspecificationandoffersbrushholderreconditioning.

Traction Motors Service• AC/DCTractionMotorRemanufacturing – D77, D78, D87, others• TractionMotorComponents• CoilProductsandServices• Remanufacturedunitsareequivalenttoobtaininganewmotor

directly from the OEM – Unit exchange programs available

Brush Holders• FulmerCompanyrebuildsusedbrushholderassembliestotheOEMspecifications,offeringthesamewarrantyasnew

• Nearlyallreturnedbrushholdersarerepairable,withanaveragecostsavingsof40%andsignificantlyreducedleadtime.Thisistypicallylessthan internal rebuild costs

• Unitexchangeprogramsareavailable

• Export,PA

Reconditioning Service Available in:

• Cleveland,OH

Reconditioning Service Available in:

Page 64: Wa Btec Locomotive Product Catalog

62

Business Unit: Wabtec Global ServicesWabtecGlobalServicesoffersfulllocomotiveshopservices,mobilemaintenance,emissionscertification,mobilewheel truing and integrated component support.

ServicesLocomotive Service

• CompletelocomotiveoverhaulsandFRA-required scheduled inspections

• Engineandtruckoverhauls• Emissionstestingandreductionpackages• Mobilemaintenanceandwheeltruing• Electricalcabinetupgradeandrebuild• Designandfabrication

Bois

e, ID

Chic

ago,

IL

Hou

ston

, TX

Salt

Lak

e Ci

ty, U

T

SERVICE CAPABILITIESLOCOMOTIVE SERVICE

Engine Overhaul • •

Engine Repair • • • •

Truck Overhaul • • •

Truck Repair • • • •

Locomotive Rebuild • • •

Fabrication / Repair • • •

Paint • •

Rotating Electrical Repair • • • •

Wheel Truing • • • •

Drop Table • •

Crane Max Capacity 50 Ton 30 Ton 30 Ton 250 Ton

Storage Track Capacity 15 5 10 10

Main Generator Replacement • • • •

Fuel Tank Repair • • •

Gear Train Repair • • • •

Burn Repair • Limited Limited Limited

Return to Service / Storage • • • •

Scheduled Maintenance • • • •

FRA Inspections • • • •

Mobile Service • • • •

Wreck Service • • • •

Page 65: Wa Btec Locomotive Product Catalog

63

Business Unit: Wabtec Global ServicesKnown as an industry leader for engineering expertise and quality in locomotive overhaul, remanufacture andmodernizationservices,Wabtechelpscustomersextendservicelife,improvereliability,andenhancetheperformanceoftheirlocomotivefleet.

Reconditioning Services — Pneumatics

Services

• WabtecGlobalServicesofferslocomotiveequipmentreconditioningfor 26 type control valve equipment, 26-C type automatic and independent brake valves, 30 CDW type automatic brake valves and modules, check valve portions, products such as air compressors, air dryers, brake cylinders, slack adjusters, cooling system products as well as EPIC equipment and a wide variety of cocks and valves.

Cars

on C

ity,

NV

Chic

ago,

IL

Colu

mbi

a, S

C

Kans

as C

ity,

MO

Mon

trea

l, Q

C (C

AN

)

San

Luis

Pot

osi

(MEX

)

SERVICE CAPABILITIESLOCOMOTIVE PRODUCTSAir CompressorsWABCO Shaft Drive and Motor Drive (GY28A Motors) • • •Gardner Denver WBO & WLN Compressors • • •Air DryersWABCO Vaporid, Graham White 975 • • • •Brake CylindersAll sizes and types of WABCO & NYAB • • • • • •Cooling System ProductsRadiators • • • •Oil Coolers • • •Charge Air Coolers • •Fuel Oil Preheaters • • •Aftercoolers / Intercoolers • • •Durox Wicks & Hatch Covers •Locomotive Brake EquipmentFast Brake • • •EPIC Equipment • • •22 & 24 Type Brake Valves • • •26 & 30 Type Brake Valves • • • • • •Control Valves (26F, 26D, MC-31) • • • • • •Safety Valves - J Series • • • • • •Safety Valves - E Series • • • • •Relay Valves (C2W, J Series) • • • • • •Pilot Valves, P-2-A Valves, MU Valves • • • • • •Vent Valves (#8, VX, KM2) • • • • • •Air Horns • • • • • •Graham White & Salem Type Valve (Wiper Motors, Drain Valves & Sander Motors) • • • • • •COBRA®Brake Shoes • • • • • •Water & Oil Pumps •Rocker Arms & Valve Bridges •

Page 66: Wa Btec Locomotive Product Catalog

64

Services

Business Unit: Wabtec Global ServicesWabtec’s FCC licensed electronic technicians follow proper ESD precautions and practices that meet industry standard,ANSI/ESDS20.20andcontinuouslyattendtrainingwithOEM’sandtechnicalschoolstostayonthe forefront of today’s technology.

• WabtecGlobalServicesoffersthefinestincomponentlevelelectronicrepair including repair, renewal and upgrade of Wabtec products as well as:– Wabtec acquisition product lines including Pulse Electronics,

Rockwell Railway Electronics, TSM, and Q-Tron– Handheld wireless equipment– Consumer and industrial goods– Motorola, Harmon, and Kenwood radios

Colu

mbi

a, S

C

Kans

as C

ity,

MO

Mon

trea

l, Q

C (C

AN

)

San

Luis

Pot

osi

(MEX

)

SERVICE CAPABILITIESELECTRONICSWRE / Pulse ProductsSpeed Indicators / Controllers (Analog/Digital) • • •Event Recorders - M Series • •Event Recorders - F&I Type • • •Axle and Traction Motor Speed Signal Generators • • •IFC Equipment - AVB, FLK, LDU, MCDLP, PCM • • •Head of Train and End of Train Devices (All Types) • • • •Battery Packs & Chargers • • •Computer Equipment - ECU’s, CDU’s, DMS’s • •Fuellink Equipment - INT’s, LDU’s, AFR’s, etc. • • •Helperlink Equipment •CBTM / ETMS •TrainSentry Alertness - Audio Alarm Panel, UAU’s, CAU’s AMU’s, etc • • •MTR Recorders • •EM2000 Equipment - CPU’s, MEM’s, etc. •SIU - ES Interface Unit •ARES / ATCS / GTC Kits •LUL Recorder / Datalogger •VideoTrax •Rockwell ProductsICE Equipment - ICE 300’s AVU’s, CCC’s, TSI’s, etc. •Communication Equipment - CTC’s Vigilant, GTC •RDR 160 / RM 160 •RDR 900 • •Train Power Supplies, Smart Key, GPS Receiver •

Reconditioning Services — Electronics

Page 67: Wa Btec Locomotive Product Catalog

65

Colu

mbi

a, S

C

Kans

as C

ity,

MO

San

Luis

Pot

osi

(MEX

)

SERVICE CAPABILITIESELECTRONICSTSM ProductsFuel Monitoring Systems • •Cab and Remote Displays • •Locomotive Temperature Controller • • •Crossing Guard Controllers •WRE (Q-Tron Products)Event Recorder - Datacord • •ERM •ACU & Actuator •Traction Control Equipment (QTRAC) • •Speed Indicators / Controllers • •Axle Generators & Sensor Probes • •Alarm Panels & Crew Alerters • •QES 1000 Excitation System •QES III Excitation System •AdditionalUltrasonic Fuel Sensors • •Kenwood Radios (Mobile, Handheld, Two-Way, Data) • •Locomotive Cab Radios •RFL Modem Cards •Radio Handsets (Microphone) • •Dash-2 Voltage Modules • •COMMUNICATIONS & SIGNALINGHand Held RadiosMotorola - HT-440, HT-600, HT-1000, MT-1000, MT-2000 •Kenwood - TK-270, TK-290, TK-370, TK-390, TK-480, TK-3131, NX 200, NX 300 •Mobile RadiosMotorola - Spectra, MCX1000, MaxTrac 300, MaxTrac 100 •Kenwood - TK 7180, NX 700, TK 780, TK 981 TK-860 (UHF), TK-862 (UHF), TK-890 (UHF) •Base RadiosWabtec - ETD / HTD Repeaters •Kenwood - TK-7400, TK-300, TK-790 •Motorola - Micor, Syntor, Spectra, MaxTrac 300, MaxTrac100, MTR 2000 •Locomotive RadiosMotorola - Spectra Clean Cab • •Detector RadiosMotorola - MaxTrac300 (Detector) •MeteorComm - MCC-545C •Kenwood - TK762 (Detector) •Radio Frequency Data Link - RFOLWabtec - RDR 160, RM 160 •Kenwood - TK790 •Mobile Communication Package (MCP)Wabtec - RDR900 • •Ground Terminal Controller (GTC)Wabtec - GTC400, GTC500 •Base Communication Package (BCP)Safetran - Base Controller with Radio, DC/DC Converter, DC/AC Inverter •Sierra Wireless ModemsRaven X, Raven XT •RFL Modem Printed Circuit Boards68T-2F-19 (TX425HZ, TX756HZ, TX1080HZ, TX2040HZ) •68R-2F / 3F-61 (REC425HZ, REC1080HZ, REC2040HZ) •Power Supply24 PS (68 PS 24 DC-1), Dual Amp (68 AF Dual Amp-1, 68 AF Dual Amp) •Field Service Maintenance - Contact Kansas City Service CenterACU & Actuator •

Reconditioning Services — Electronics

Services

Page 68: Wa Btec Locomotive Product Catalog

[email protected]

©2012 Wabtec Corporation WAB-0712-2

Bach-SimpsonP.O. Box 5484109 Meg DriveLondon, Ontario N6A 4L6 - CanadaPhone: 519-452-3200Fax: 519-452-3165

Barber Spring1 McCandless Ave.Pittsburgh, PA 15201 Phone: 412-782-7330Fax: 412-782-7343

Durox12312 Alameda RoadStrongsville, OH 44149 Phone: 440-238-5350Fax: 440-238-5773

Fulmer Company3004 Venture Court Export, PA 15632Phone 724-325-7140Fax: 724-327-7459

Microphor452 East Hill RoadWillits, CA 95490 Phone: 707-459-5563Fax: 707-459-6617

MotivePower4600 Apple StreetBoise, ID 83716 Phone: 208-947-4800Fax: 208-947-4820

Railroad Friction Products Cor P.O. Box 1349Laurinburg, NC 28353Phone: 910-844-9700Fax: 910-844-9733

Standard Car Truck865 Busse HighwayPark Ridge, IL 60068 Phone: 847-692-6050Fax: 847-692-6299

Swiger Coil Systems4677 Manufacturing Rd.Cleveland, OH 44135 Phone: 216-362-7500Fax: 216-362-1496 Triangle Engineered Products701 Maple LaneBensenville, IL 60106 Phone: 630-860-5511 Fax: 630-860-5607 WABCO Locomotive Products 1001 Air Brake Avenue Wilmerding, PA 15148 Phone: 412-825-1000 Fax: 412-825-1019 Wabtec Railway Electronics 21200 Dorsey Mill Road Germantown, MD 20876 Phone: 301-515-2000Fax: 301-515-2100

Wabtec Rubber Products 269 Donohoe RoadGreensburg, PA 15601 Phone: 724-838-1317Fax: 724-832-5630

Young Touchstone200 Smith LaneP.O. Box 7568Jackson, TN 38308 Phone: 1-800-349-0275Fax: 731-265-2302

Wabtec Global Services Wabtec Global Services 1001 Air Brake Avenue Wilmerding, PA 15148 Phone: 1-877-922-2627 5401 Arrowhead Dr. Carson City, NV 89706Phone: 775-882-0282 Fax: 775-882-4796

8400 S. Stewart Ave. Chicago, IL 60620 Phone: 773-602-7476 Fax: 773-602-7483 1222 Bluff Rd. Columbia, SC 29201 Phone: 803-256-1612 Fax: 803-799-8402 4800 Deramus Ave. Kansas City, MO 64120 Phone: 816-245-5450 Fax: 816-245-5460 4600 Apple Street Boise, ID 83716 Phone 208-947-4800 Fax: 208-947-4820 900 North 500 South Salt Lake City, UT 84116 Phone: 801-201-8977 800 Milby Street Houston, TX 77023 Phone: 713-222-0792 Fax: 713-222-2183

2610 Jean Baptiste Dechamps Lachine, QC Canada H8T 1C9 Phone: 514-636-3115 Fax: 514-636-8740

EJE 126 No. 230 Zona Industrial del Potosi San Luis Potosi, SLP Mexico 78090 Phone: 52-444-834-4807