Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT...
Transcript of Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT...
![Page 1: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/1.jpg)
Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT) )
Author(s) RAJESH, CHAHOTA
Report No.(DoctoralDegree) 博士(獣医学) 甲第226号
Issue Date 2007-03-13
Type 博士論文
Version author
URL http://hdl.handle.net/20.500.12099/21409
※この資料の著作権は、各資料の著者・学協会・出版社等に帰属します。
![Page 2: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/2.jpg)
Pathogenesis of Chlamydial Infections
!"#$%&'()*+%,-./0
2006
The United Graduate School of Veterinary Sciences, Gifu University,
(Gifu University)
RAJESH CHAHOTA
![Page 3: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/3.jpg)
Pathogenesis of Chlamydial Infections
!"#$%&'()*+%,-./0
RAJESH CHAHOTA
![Page 4: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/4.jpg)
i
CONTENTS
PREFACE……………………………………………………………………… 1
PART I
Molecular Epidemiology, Genetic Diversity, Phylogeny and Virulence Analysis
of Chlamydophila psittaci
CHAPTER I: Study of molecular epizootiology of Chlamydophila psittaci among
captive and feral avian species on the basis of VD2 region of ompA gene
Introduction……………………………………………………………… 7
Materials and Methods…………………………………………………... 9
Results…………………………………………………………………… 16
Discussion……………………………………………………………….. 31
Summary……………………………………………………………….... 35
CHAPTER II: Analysis of genetic diversity and molecular phylogeny of the
Chlamydophila psittaci strains prevalent among avian fauna and those associated with
human psittacosis
Introduction……………………………………………………………… 36
Materials and Methods…………………………………………………... 38
Results…………………………………………………………………… 42
Discussion……………………………………………………………….. 55
Summary………………………………………………………………… 59
CHAPTER III: Examination of virulence patterns of the Chlamydophila psittaci strains
predominantly associated with avian chlamydiosis and human psittacosis using BALB/c
mice
Introduction……………………………………………………………… 60
Materials and Methods…………………………………………………... 63
Results…………………………………………………………………… 66
Discussion……………………………………………………………….. 74
Summary………………………………………………………………… 76
![Page 5: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/5.jpg)
ii
PART II
Investigation of the Emergence of Chlamydial Infection in Animals and Human
Disease Conditions
CHAPTER IV: Involvement of multiple Chlamydia suis genotypes in porcine
conjunctivitis in commercial farms of Japan
Introduction……………………………………………………………… 79
Materials and Methods…………………………………………………... 80
Results…………………………………………………………………… 86
Discussion……………………………………………………………….. 92
Summary………………………………………………………………… 98
CHAPTER V: Molecular characterization of the Chlamydophila caviae strain OK135,
isolated from human genital tract infection, by analysis of some structural and
functional genes
Introduction……………………………………………………………. 99
Materials and Methods………………………………………………… 100
Results…………………………………………………………………. 103
Discussion……………………………………………………………... 108
Summary………………………………………………………………. 110
CONCLUSION………………………………………………………………… 112
REFERENCES…………………………………………………………………. 116
ACKNOWLEDGMENTS……………………………………………………… 140
![Page 6: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/6.jpg)
1
Chlamydiae are the obligate intracellular bacterial pathogens of animals and human
beings (185, 188). They replicate within the cytoplasm of host cells, forming characteristic
intracellular inclusion bodies. The chlamydiae undergo a unique biphasic developmental
cycle characterized by two morphologically distinct forms, the elementary body (EB) and
the reticulate body (RB). EBs are small (0.2–0.3 µm in diameter) infectious forms that are
either endocytosed or phagocytosed by host cells. The EB within an intracytoplasmic
inclusion, transforms into the larger (0.5–1.6 µm in diameter) intracellular non-infectious,
metabolically active, RB. The RB multiplies by binary fission and fills the inclusion,
which expands in size. RBs re-condense back into EBs via intermediate bodies towards the
end of the cycle (24–48 hr, depending on species and strains) and are then released from the
host cell by lysis or exocytosis to initiate another cycle of infection (75, 119, 131, 216).
The EB, in contrast to the RB, is structurally rigid, resulting from the formation of
extensive disulphide linkages between various cysteine-rich proteins in or associated with the
outer membrane. The chlamydial outer membrane consists of lipopolysaccharide (LPS),
polymorphic outer membrane proteins (POMPs), peptidoglycan and cysteine-rich proteins
like major outer membrane protein (MOMP), OmcA and OmcB. The most important of
these is the MOMP, which makes up 60% of the weight of the outer membrane. MOMP is
about 40- to 45-Kda in mass and contains serovar- and species-specific epitopes. MOMP
acts as porins, channels to allow exchange of molecules including nutrients. The high
rigidity results in EBs being resistant to both chemical and physical factors and therefore,
adapted for prolonged extracellular survival, an important factor in terms of chlamydial
pathogenesis and control or treatment of chlamydial infections (75, 176).
Earlier all chlamydiae were placed in order Chlamydiales, family Chlamydiaceae
and one genus Chlamydia that included 4 species: C. trachomatis, C. psittaci, C.
PREFACE
![Page 7: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/7.jpg)
2
pneumoniae and C. pecorum (52, 64, 132). Following reclassification of the order
Chlamydiales in 1999, the family Chlamydiacaeae is now divided into two genera,
Chlamydia and Chlamydophila (43). The genus Chlamydia comprises of Chlamydia
trachomatis, Chlamydia suis and Chlamydia muridarum species. The genus
Chlamydophila contains the species Chlamydophila pneumoniae, Chlamydophila psittaci,
Chlamydophila abortus, Chlamydophila pecorum, Chlamydophila felis and Chlamydophila
caviae.
Chlamydiae are responsible for a diverse range of diseases in birds and mammals
including humans. Among human chlamydial infections, C. trachomatis causes blindness
(trachoma), sexually transmitted disease and infertility. C. pneumoniae is a cause of acute
respiratory infection, coronary heart disease and chronic inflammatory lung diseases viz.
chronic obstructive pulmonary disease and asthma (71, 105, 177).
Animal chlamydial infections are caused by many chlamydial species. In genus
Chlamydia, C. suis is associated with either asymptomatic infections or cause
conjunctivitis, enteritis, pneumonia and genital tract infections in domesticated and wild
porcine (99, 165, 183). C. muridarum causes either no disease or asymptomatic
pneumonitis among mice and hamsters (40, 48). In genus Chlamydophila, C. pecorum is
associated with chronic conditions viz. pneumonia, polyarthritis, conjunctivitis, enteritis,
encephalomyelitis, metritis and mastitis among ruminants, swine and marsupials (40, 52).
C. felis is responsible for “feline chlamydiosis”, which is characterized by rhinitis and
conjunctivitis in cats, particularly kittens (192). Studies conducted in Japan have shown C.
felis to be more widespread in stray cats than in pet cats (26, 57, 222). C. abortus is a cause
of abortion in sheep, goats and responsible for reproductive failure in bovine, equine and
porcine (40, 113, 160). C. psittaci causes “avian chlamydiosis” among many avian species
(reported 460 avian species) and can also infect mammalian species (8, 94, 210). Avian
chlamydiosis is characterized by diarrhea, anorexia, respiratory distress, sinusitis, rhinitis
![Page 8: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/8.jpg)
3
and conjunctivitis (8, 188). C. caviae is a host specific pathogen of guinea pigs and causes
either self-limiting or asymptomatic inclusion conjunctivitis among young (4-8 weeks old)
guinea pigs (63, 101, 135). C. pneumoniae is also reported from marsupials and equines
(62, 218).
Animal chlamydial infections also have public health hazard significance. Among
all chlamydial species infecting animals, C. psittaci, C. abortus and C. felis are potential
zoonotic pathogens (113). C. abortus can cause severe, life-threatening disease in pregnant
women. Infection in women during pregnancy can result in spontaneous abortion or
stillbirths, which are typically preceded by several days of acute influenza-like illness, as well
as renal failure, hepatic dysfunction, disseminated intravascular coagulation, and possibly
death (25, 87). Cases of C. felis infection associated with conjunctivitis and atypical
pneumonia in humans have been reported over the years (19, 113), but it is only recently
that compelling evidence of transmission from cats to humans has been provided by way
of molecular classification techniques (74). In Japan serological evidence of human C. felis
infection has been reported (222).
The zoonotic infection by C. psittaci, is particularly a significant occupational health
hazard to the workers in poultry industry, aviaries, zoos and also pet shop owners, farmers
and veterinarians. Infection in humans can vary in severity but is usually associated with
respiratory disease. But multiple organs may become infected resulting in endocarditis,
myocarditis, hepatitis, encephalitis or meningitis and result in deaths (113, 181, 210). The
financial losses resulting from this disease, particularly those incurred in the poultry and pet
industries, combined with the fact that this is the most common animal chlamydiosis
transmissible to man, highlights the economic importance and public health significance of
avian chlamydiosis. The incidences of zoonotic infection by C. caviae, C. pecorum, C. suis
and C. muridarum are unknown (113).
Defining the distribution of natural chlamydial infections in animals and human and
its relationship to pathogenesis provides the fundamental basis for management and control
![Page 9: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/9.jpg)
4
of chlamydial diseases. The final outcome of chlamydial infection in animals and human
depends on large numbers of host and organism specific factors (217). Genetic and
biological differences among various chlamydial species/strains are well known. Different
pathobiotypes of C. trachomatis strains have been recognized, which include trachoma,
urogenital and lymphogranuloma venereum (LGV) biovars. These biovars varies in tissue
tropism and host specific cellular response which indicates variation in disease causation
mechanism (128, 137, 214). In C. pneumoniae also, human, equine and koala biovars are
known. The virulence and genetic distinction of C. abortus strains causing abortion in
ewes from non abortifacient strains has also been established (38, 159, 162). However, in
C. psittaci no such relationship has been explored among various genetically diverse
strains even though it has been detected from diverse host rage and disease conditions. On
the other hand, some studies have found varied virulence of C. psittaci strain to avian
species (212). Therefore, detailed molecular epidemiological studies of animal chlamydial
species by screening variety of host species and disease conditions is important to identify
association of particular species/strain with specific disease syndrome.
The diagnosis of chlamydial infections and analysis of chlamydial diversity are
done by isolation, serological and biotyping studies (175, 184, 220). But these procedures
are time consuming and high technical skills are required for testing samples. Therefore,
the recent epidemiological studies are mostly contemplated by detecting species/strain
specific gene (DNA) by nucleic acid amplification using polymerase chain reaction (PCR).
By this technique even a very small amount of EBs can be detected. The genetic diversity
among the prevalent chlamydial species/strains can be studied by sequencing and
genetically analyzing the amplified DNA fragment (59, 80, 83, 96, 97, 148).
The differentiation at the species level among various chlamydiae is usually done
by genetic analysis of highly conserved genes like 16S ribosomal RNA, 16S-23S
![Page 10: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/10.jpg)
5
ribosomal RNA intergenic spacer region, rnpB and groEL-1 genes (24, 41, 54, 79, 149,
193, 205). However, for the identification at strain level, ompA gene coding MOMP has
been targeted in many studies (38, 47, 50, 60, 173, 191).
For identification and differentiation of C. psittaci isolates especially of avian
origin, ompA gene was analyzed by many researchers (50, 98, 174, 191, 207). Depending
on serovar specific monoclonal antibody typing, 8 serotypes named A to H have been
identified in C. psittaci (4, 56, 206, 207). Based on AluI restriction fragment length
polymorphism (RFLP) pattern of ompA gene, C. psittaci strains are also divided into 7
genotypes from A to F and E/B (60, 174, 207), but serotyping and RFLP studies do not
reflect the actual genetic diversity (60).
Therefore, the detailed investigations about natural distribution, molecular
identification, genetic diversity and virulence of various chlamydial species/strains of
animal origin are necessary to understand disease pathogenesis. Hence, to elucidate some
of these questions the present study was undertaken with the following objectives:
1) Study of molecular epizootiology of Chlamydophila psittaci among captive and feral
avian species on the basis of VD2 region of ompA gene.
2) Analysis of genetic diversity and molecular phylogeny of Chlamydophila psittaci
strains prevalent among avian fauna and those associated with human psittacosis.
3) Examination of virulence patterns of Chlamydophila psittaci strains predominantly
associated with avian chlamydiosis and human psittacosis using BALB/c mice.
4) Investigation of the emergence of chlamydial infection among animals and human
disease conditions.
These findings will help to identify predominant/emergent chlamydial genotypes
prevalent among domesticated and wild fauna, with/without disease symptoms and also
those with high zoonotic potential for better understanding of disease pathogenesis.
![Page 11: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/11.jpg)
6
PART I
Molecular Epidemiology, Genetic Diversity, Phylogeny and Virulence
Analysis of Chlamydophila psittaci
![Page 12: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/12.jpg)
7
f
Study of molecular epizootiology of Chlamydophila psittaci among captive
and feral avian species on the basis of VD2 region of ompA gene
INTRODUCTION
Chlamydiae are obligate intracellular pathogens and widely prevalent among avian
species, animals and human beings (7, 51, 132, 188). According to the recent classification
based upon 16S rRNA gene sequences, all the chlamydiae are divided into four families
(43). Chlamydophila species belonging to the family Chlamydiaceae are often involved in
the infection of avian species and domestic animals (43, 53).
The avian chlamydiosis is caused by Chlamydophila psittaci. The disease is
characterized by clinical and/or subclinical infection. The clinical signs vary in severity
and disease is usually systemic with up to 30% mortality (8, 188). C. psittaci has been
reported in more than 400 avian species and occasionally in non-avian hosts (8, 94, 143,
182, 209). C. psittaci is usually transmitted horizontally to in-contact animals and human
beings by diseased or subclinically infected birds (35, 112, 113, 115, 181). People are
frequently exposed to diverse type of domestic and/or feral avian fauna in daily life either
incidentally or occupationally. Furthermore, the feral birds congregated in urban public
habitations also contaminate the environment with C. psittaci laced aerosols and droppings
(30, 55, 70, 202). In Japan, 45 cases of human psittacosis in 2002, 44 in 2003 and 36 in
2004 were reported (136) and in USA 935 cases were reported from 1988 to 2003 (181).
Many more cases may have occurred but are neither correctly diagnosed nor reported due
to confusing symptoms.
CHAPTER-I
![Page 13: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/13.jpg)
8
Immunodiagnostic and biotyping studies (31, 184, 220) were reported to identify
various avian species harboring C. psittaci and to detect chlamydial diversity. Depending
on serovar specific monoclonal antibody typing, 8 serotypes named A to H have been
identified in C. psittaci (4, 56, 206, 207). In the last decade, for identification and
differentiation of C. psittaci isolates especially of avian origin, ompA gene coding major
outer membrane protein (MOMP) was analyzed by many researchers (50, 98, 174, 191,
207). On the basis of AluI restriction fragment length polymorphism (RFLP) pattern of
ompA gene, C. psittaci strains are also divided into 7 genotypes from A to F and E/B (60,
174, 207), but serotyping and RFLP studies do not reflect the actual genetic diversity (60).
The ompA gene consists of genetically conserved fragments called conserved/constant
domains (CD) flanking 4 genetically variable domains (VD). The VDs of ompA gene are
reported to have species/strain specific sequences and thus can be analyzed for
identification of chlamydial species/strains and also to study the genetic diversity directly
from field samples after PCR amplification (12, 86, 96, 148, 225).
The detailed epizootiological study of avian chlamydiosis is essential to know the
prevalence of different chlamydial strains/species among various avian species and to
ascertain the possibility of health hazard risk to in-contact animals and human beings.
Moreover, limited information is available in literature on the current molecular
epizootiology and genetic diversity of C. psittaci after reclassification of avian and
mammalian isolates of the previous Chlamydia psittaci group (43). Therefore, the present
research was planned to investigate the molecular epizootiology and genetic diversity
among C. psittaci strains and/or other chlamydial species prevalent in diverse avian fauna.
It appears that various genetically diverse chlamydial species and strains may cause avian
chlamydiosis but some strains of C. psittaci are highly prevalent and are frequently
associated with clinical/subclinical infections.
![Page 14: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/14.jpg)
9
MATERIALS AND METHODS
Samples examined: A total of 1,147 samples from 11 avian orders were collected
from 4 avian pet shops, 3 bird sanctuaries/wild animal rehabilitation centers, 3 bird
parks/zoos and 14 veterinary hospitals located in 11 prefectures of Japan from January
2003 to December 2004. The collected samples included the cloacal swabs or freshly
voided feces and/or whole blood in heparin and/or pieces of visceral organs (1-2 g)
including lung, liver, spleen, heart and posterior intestinal loop from dead birds. The avian
fauna screened in the study is shown in Table 1. The distribution of tested samples
according to clinical history and sources are shown in Table 2. In total, 11 avian orders
include 28 genera and 81 species from psittacine birds and 25 genera comprising of 32
species from non-psittacine birds.
DNA extraction: SepaGene DNA extraction Kit (Sanko Junyaku, Tokyo, Japan)
was used to extract DNA from samples according to the manufacturer’s instructions. In
brief, about 200 mg of fecal/tissue material or 50 µl of blood or cloacal swabs suspended
in 700 µl of phosphate-buffered saline (PBS), pH 7.4 were processed for DNA extraction.
DNA was finally dissolved in 30 µl Tris-EDTA (TE) buffer, pH 7.4 (100 mM Tris-HCl,
pH 7.4 and 10 mM EDTA, pH 8.0) and stored at –30°C. DNA extracted from purified
elementary bodies of GPIC strain of Chlamydophila caviae (ATCC VR-813) was used as a
positive control in the test.
Nested PCR: Two sets of consensus oligonucleotide primers based on ompA gene
were used in a two-steps procedure. An outer pair of primers CMGP-1F (5'-
CCTTGTGATCCTTGCGCTACTTG-3'; nucleotide (nt) 138 to 160 in ompA gene
sequence of 6BC strain of C. psittaci with accession number X56980) and CMGP-1R (5'-
GTGAGCAGCTCTTTCGTTGAT-3'; nt 1184 to 1164) and an inner pair of primers
![Page 15: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/15.jpg)
Table 1. Details of the avian species screened in the study.
Order Family Genus (sample no.) Avian species and number of samples testeda
Psittaciformes Cacatuidae Cacatua (98) C. alba (Umbrella or White-crested Cockatoo)-27; C. galerita (Sulphur-crested Cockatoo)-3; C. triton (Tritone Cockatoo)-3; C. tenuirostrius
(Long-billed Corella)-1; C. sulphurea (Yellow-crested Cockatoo)-26; C. sanguinea (Little Cockatoo)-1; C. leadbeateri (Pink Cockatoo)-2;
C. sulphurea citrinocristana (Citron-crested Cockatoo)-17; C. moluccensis (Moluccan or Salmon-crested Cockatoo)-18
Eolophus (9) E. roseicapillus (Roseate Cockatoo or Galah)-9
Nymphicus (77) N. hollandicus (Cockatiel)-77
Psittacidae Agapornis (11) A. roreicollis (Peached-faced Lovebird)-10; A. lilianae (Lilian Lovebird)-1
Amazona (13) A. aestiva (Blue-fronted Amazon)-6; A. aestiva xanthopteryx (a type of Blue-fronted Amazon)-1; A. ochrocephala (Yellow-crowned Amazon)-3;
A. auropalliata (Yellow-naped Amazon)-1; A. xanthops (Yellow-faced Amazon)-1; A. farinosa (Mealy Amazon)-1
Ara (55) A. nobilis (Red-shouldered Macaw)-2; A. chloroptera (Green-winged Macaw)-10; A. ararauna (Blue-and-Yellow Macaw)-11; A. severa
(Chestnut-fronted Macaw)-7; A. auricollis (Yellow-collard Macaw)-23; Ara sp. (Harlequin Macaw)-1; A. macao (Scarlet Macaw)-1
Aratinga (44) A. aurea (Peach-fronted Conure)-3; A. wagleri (Scarlet or Red-fronted Conure)-2; A. jandaya (Jandaya Conure)-6; A. solstitialis (Sun Conure)-9;
A. erythrogenys (Red-masked Conure)-5; A. weddellii (Dusky-headed Conure)-5; A. acuticaudata (Blue-crowned Conure)-7; A. pertinax
(St. Thomas Conure)-1; A. guarouba (Golden Conure)-2; A. rubritorquis (Red-throated Conure)-4
Bolborhynchus (1) B. lineola (Barred Parakeet )-1
Brotogeris (2) B. chrysopterus (Golden-winged Parakeet )-2
Cyanoliseus (1) C. patagonus (Patagonia Conure)-1
Eclectus (10) E. roratus (Eclectus Parrot)-10
Eos (3) E. bornea (Red Lory)-1; E. reticulata (Blue-streaked Lory)-2
Forpus (1) F. coelestis (Pacific Parrotlet)-1
Lorius (11) L. lory (Black-capped Lory)-5; L. garrulus (Chattering Lory)-1; L. chlorocerus (Yellow-bibbed Lory)-5
Melopsittacus (59) M. undulatus (Budgeriger)-59
Myiopsitta (1) M. monachus (Quaker or Monk Parrot)-1
Neophema (2) N. bourkii (Bourke's Parrot)-2
Pionites (14) P. melanocephala (Black-headed Caique)-6; P. leucogaster (White-bellied Caique )-8
Pionus (12) P. senilis (White-crowned Parrot)-4; P. fuscus (Dusky Parrot)-1; P. menstruus (Blue-headed Parrot)-4; P. chalcopterus (Bronze-winged Parrot)-3
Platycerus (1) P. elegans (Crimson Rosella)-1
Poicephalus (121) P. cryptoxanthus (Brown-headed Parrot)-26; P. meyeri (Meyer's Parrot/Broun Parrot)-19; P. rueppellii (Rüppell's parrot)-7; P. rufiventris
(Red-bellied Parrot)-4; P. senegalus (Senegal Parrot)-42; P. gulielmi (Red-crowned/Jardine's Parrot)-23
Polytelis (3) P. anthopeplus (Regent Parrot)-2; P. alexandrae (Alexandra's Parrot)-1
Pseudeos (7) P. fuscata (Dusky Lory)-7
Psittacula (12) P. krameri manillensis (Indian Ring-neck Parakeet)-2; P. eupatria (Alexandrine Parakeet)-4; P. derbiana (Derbyan Parakeet)-3; P. cyanocephala
(Plum-headed Parakeet)-3
Psittacus (163) P. erithacus (African Grey Parrot)-154; P. erithacus timneh (Timneh Grey Parrot)-9
Pteroglossus (2) P. aracari (Black-necked Aracari)-2
Pyrrhura (21) P. molinae (Green-cheecked Conure)-4; P. egregia (Fiery-shouldered Conure)-3; P. rupicola (Rock or Black-capped Conure)-2; P. frontalis
(Red-bellied Conure)-3; P. rhodocephala (Rose-headed Conure)-1; P. perlata lepida (Pearly Conure)-5; P. hypoxantha sallvadori
(Yellow-sided Conure)-3
Trichoglossus (52) T. haematodus (Green-naped Lorikeets or Rainbow Lory)-49; T. haematodus capistratus (Edward's Lorikeet)-3
![Page 16: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/16.jpg)
Anseriformes Anatidae Anas (3) Anas sp. (Duck)-3
Branta (1) B. sandvicensis (Hawaiian Goose)-1
Cairina (1) C. moschata (Muscovy Duck)-1
Ciconiiformes Ardeidae Nycticorax (1) N. nycticorax (Black-crowned Night Heron)-1
Ciconiidae Ciconia (256) C. ciconia (White Stork)-256
Columbiformes Columbidae Columba (2) Columba livia (Pigeon)-2
Cuculiformes Musophagidae Tauraco (10) T. persa (Guinea Turaco)-4; T. livingstonii (Livingstone's Turaco)-5; T. hartlaubi (Hartlaub's Turaco)-1
Musophaga (7) M. violacea (Violet Turaco)-7
Galliformes Phasianidae Lophura (1) L. nycthemera (Silver Pheasent)-1
Gallus (5) G. domesticus (Chicken and Chicken Silkie Bantom)-5
Coturnix (3) C. japonica (Japanese Quail )-3
Pavo (2) P. cristatus (Common Pea Fowl)-2
Gruiformes Gruidae Grus (14) G. japonensis (Red Crowned Crane)-14
Passeriformes Estrildidae Padda (5) P. oryzivora (Java Sparrow)-5
Fringillidae Coccothraustes (1) C. coccothraustes (Hawfinch)-1
Lagopus (1) L. mutus (Rock Ptarmigan)-1
Hirundinidae Hirundo (1) H. rustica (Barn Swallow)-1
Ploceidae Passer (1) P. montanus (Eurasian Tree Sparrow)-1
Pycnonoyidae Hypsipetes (1) H. amaurotis (Brown-eared Bulbul )-1
Sturnidae Gracula (2) G. religiosa (Southern Grackle or Hill Mynah)-2
Sturnus (1) S. cineraceus (Grey Starling)-1
Piciformes Ramphastidae Ramphastos (11) R. toco (Toco Toucan)-3; R. tucanus (Red-billed Toucan)-3; R. sulfuratus (Keel-billed Toucan)-1; R. vitellinus (Channel-billed Toucan)-3;
R. swainsonii (Chestnut-mendibled Toucan)-1
Sphenisciformes Sphaniscidae Spheniscus (5) S. demersus (Cape Penguin)-5
Strigiformes Strigidae Bubo (5) B. bengalensis (Bengal Eagle Owl)-3; B. virginianus (Horned Owl)-2
Tytonidae Tyto (1) T. alba (Barn Owl)-1
a Common names of avian species are shown in the parentheses.
![Page 17: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/17.jpg)
Table 2. Type of avian fauna screened and distribution according to clinical history and sources of sampling.
Order Family Genus Total samples
(sample no.) (sample no.) Normal Sicke Dead Normal Sicke Dead Normal Sicke Dead Normal Sicke Dead
Psittaciformes (806) Cacatuidae (184) Cacatua 7 0 0 91 0 0 0 0 0 0 0 0 98
Eolophus 3 0 0 4 0 0 1 0 1g 0 0 0 9
Nymphicus 24 10 0 36 0 0 7 0 0 0 0 0 77
Psittacidae (622) Agapornis 7 3 0 1 0 0 0 0 0 0 0 0 11
Amazona 4 1 0 8 0 0 0 0 0 0 0 0 13
Ara 5 4 0 12 0 0 7 20 7f 0 0 0 55
Aratinga 1 0 0 42 0 0 1 0 0 0 0 0 44
Bolborhynchus 0 0 0 1 0 0 0 0 0 0 0 0 1
Brotogeris 0 0 0 2 0 0 0 0 0 0 0 0 2
Cyanoliseus 0 0 0 1 0 0 0 0 0 0 0 0 1
Eclectus 0 0 0 9 0 1 0 0 0 0 0 0 10
Eos 0 0 0 3 0 0 0 0 0 0 0 0 3
Forpus 0 1 0 0 0 0 0 0 0 0 0 0 1
Lorius 0 0 0 11 0 0 0 0 0 0 0 0 11
Melopsittacus 15 25 4 1 0 0 14 0 0 0 0 0 59
Myiopsitta 0 0 0 1 0 0 0 0 0 0 0 0 1
Neophema 0 1 0 1 0 0 0 0 0 0 0 0 2
Pionites 2 1 0 10 0 1 0 0 0 0 0 0 14
Pionus 3 0 0 9 0 0 0 0 0 0 0 0 12
Platycerus 0 0 0 1 0 0 0 0 0 0 0 0 1
Poicephalus 1 0 0 118 2 0 0 0 0 0 0 0 121
Polytelis 0 0 0 3 0 0 0 0 0 0 0 0 3
Pseudeos 0 0 0 7 0 0 0 0 0 0 0 0 7
Psittacula 0 0 0 12 0 0 0 0 0 0 0 0 12
Psittacus 6 1 0 154 1 0 1 0 0 0 0 0 163
Pteroglossus 0 0 0 2 0 0 0 0 0 0 0 0 2
Pyrrhura 2 1 0 18 0 0 0 0 0 0 0 0 21
Trichoglossus 0 0 0 6 0 0 29g 4 13g 0 0 0 52
Anseriformes (5) Anatidae (5) Anas 1 0 0 0 0 0 2 0 0 0 0 0 3
Branta 1 0 0 0 0 0 0 0 0 0 0 0 1
Cairina 1 0 0 0 0 0 0 0 0 0 0 0 1
and wild faunad
Bird sanctuaries
Source and clinical status wise division of the samples
Classification of the screened avian fauna Veterinary hospitalsa Bird parks and zooscPet shopsb
![Page 18: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/18.jpg)
Ciconiiformes (257) Ardeidae (1) Nycticorax 0 0 0 0 0 0 0 0 0 0 1 0 1
Ciconiidae (256) Ciconia 0 0 0 0 0 0 0 0 0 254 0 2 256
Columbiformes (2) Columbidae (2) Columba 0 0 0 0 0 0 2 0 0 0 0 0 2
Cuculiformes (17) Musophagidae (17) Tauraco 0 0 0 0 0 0 10 0 0 0 0 0 10
Musophaga 0 0 0 0 0 0 7 0 0 0 0 0 7
Galliformes (11) Phasianidae (11) Lophura 0 0 0 0 0 0 1 0 0 0 0 0 1
Gallus 3 0 0 0 0 0 2 0 0 0 0 0 5
Coturnix 0 0 0 0 0 0 3 0 0 0 0 0 3
Pavo 0 0 0 0 0 0 2 0 0 0 0 0 2
Gruiformes (14) Gruidae (14) Grus 0 0 0 0 0 0 14 0 0 0 0 0 14
Passeriformes (13) Estrildidae (5) Padda 4 0 0 0 0 0 1 0 0 0 0 0 5
Fringillidae (2) Coccothraustes 0 0 0 0 0 0 0 0 0 0 1 0 1
Lagopus 0 0 0 0 0 0 0 0 0 0 0 1 1
Hirundinidae (1) Hirundo 0 0 0 0 0 0 1 0 0 0 0 0 1
Ploceidae (1) Passer 1 0 0 0 0 0 0 0 0 0 0 0 1
Pycnonoyidae (1) Hypsipetes 1 0 0 0 0 0 0 0 0 0 0 0 1
Sturnidae (3) Gracula 1 0 1 0 0 0 0 0 0 0 0 0 2
Sturnus 0 0 0 0 0 0 0 0 0 0 1 0 1
Piciformes (11) Ramphastidae (11) Ramphastos 0 0 0 0 0 0 11 0 0 0 0 0 11
Sphenisciformes (5) Sphaniscidae (5) Spheniscus 0 0 0 0 0 0 5 0 0 0 0 0 5
Strigiformes (6) Strigidae (5) Bubo 0 0 0 0 0 0 5 0 0 0 0 0 5
Tytonidae (1) Tyto 0 0 0 0 0 0 1 0 0 0 0 0 1
Total 93 48 5 564 3 2 127 24 21 254 3 3 1147
a Include samples from hospitals located in Nara, Tokyo, Gifu, Aichi, Saitama, Okinawa, Kanagawa, Kyoto and Fukuoka prefectures of Japan and represents birds those were
individually or pair wise caged and kept as pets in households. b Mostly birds were imported from South Africa, Singapore, Thailand and USA or in house bred by pet shops (located at Tokyo, Aichi, Osaka and Hyogo prefectures) and sold to
various clients. c Include birds kept in large enclosures as colonies in artificial habitats and are exposed to human contact continuously. These bird parks or zoos are located in Okinawa, Hokkaido
(Kushiro), Hyogo and Shimane prefectures of Japan.d The samples represent birds living in natural or near natural habitats and also includes oriental white storks imported from Russia. Samples were collected from Hokkaido and Gifu
prefectures. e The birds showing the chlamydia specific or unrelated clinical signs and are not clinically normal. f Include samples from outbreak-I in a bird park at Shimane prefecture.g Include samples from outbreak-II in another bird park at Okinawa prefecture.
![Page 19: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/19.jpg)
14
CMGP-2F (5'-GCCTTAAACATCTGGGATCG-3'; nt 384 to 403), CMPG-2R (5'-
GCACAACCACATTCCCATAAAG-3'; nt 634 to 613) was used for the first and second
steps, respectively. Five µl of the first step PCR product was used for the second step PCR.
This test is able to detect 2 to 10 copies of genomic DNA of diverse types of
Chlamydophila sp. in a 50 µl reaction mixture (data not shown). The primers were
synthesized by the Rikaken Co., Nagoya, Japan. In both steps, reaction was performed in
50 µl reaction mixture containing 0.15 µM of each forward and reverse primer, 250 µM of
each dATP, dTTP, dGTP, dCTP, 100 µM of Mg2+
in buffer and 2.5 units of TaKaRa Ex-
Taq (Takara Bio Inc., Otsu, Shiga, Japan) and 2.0 to 5.0 µg of template DNA of each
sample. The thermo cycling conditions used were initial denaturation at 94°C for 3 min,
then 35 cycles of denaturation at 94°C for 30 sec, annealing at 55°C for 30 sec and
extension at 72°C for 60 sec, then final extension for 5 min at 72°C and soaking at 4°C. In
the second step PCR; the same thermal cycle conditions were used except shorter
extension period of 30 sec. The DNA of C. caviae was used as positive control and PBS
(pH 7.4) and water were used as negative controls.
Cloning of PCR product and sequencing: The PCR products after second step
were purified by gel electrophoresis using low melting agarose gel in Tris-acetate-EDTA
(TAE) buffer, pH 7.4 followed by QIAquick Gel Extraction kit (Qiagen, Hilden,
Germany). The DNA fragment was cloned in pGEM-T vector (Promega, Madison,
Wisconsin) and DH5! strain of E. coli (Tyobo Co., Osaka, Japan) was used for
transformation by heat shock method (171). DNA insert containing clones were selected
on Luria-Bertani (LB) medium plates containing isopropyl-"-D-thiogalactopyranoside
(IPTG) (23.8 µg/ml), ampicillin (50 µg/ml) and 5-Bromo-4-Chloro-"-D-Galactoside (X-
gal) (40 µg/ml) (171). From each sample, 3 to 5 clones with expected size DNA insert
were taken for sequencing. We preferred cloning and sequencing over direct sequencing
![Page 20: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/20.jpg)
15
because DNA of normal intestinal flora (fecal samples) interfered with direct sequencing.
The sequencing was done using the dye-terminator method and performed by a
commercial resource (Dragon Genomics Co., Yokkaichi, Mia, Japan). Both strands were
read. The sequences were assembled and edited using Genetyx-Mac/ATSQ 4.2.3 and
Genetyx-Mac, version 13.0.6 (SDC, Tokyo, Japan).
Analysis of sequences and construction of phylogenetic trees: The chlamydia
species and strains were identified by NCBI-BLAST (http://www.ncbi.nlm.nih.gov) search
of nucleotide and deduced amino acids sequences. For phylogenetic analysis, the ompA
gene sequences of C. psittaci strains and each representative species of genus
Chlamydophila as well as Chlamydia trachomatis were retrieved from the DNA Data Bank
of Japan (DDBJ). Multiple alignments of the trimmed sequences were done using
ClustalX, version 1.83 (198).
Phylogenetic analysis was done with programs in the Phylogeny Inference Package
software (PHYLIP) (version 3.6a3; [http://evolution.genetics.washington.edu
/phylip.html]). The distance matrix between species was computed by DNADIST using
F84 model (46, 102) and clustering of lineages was done by NEIGHBOR using neighbor-
joining method (170). The phylogenetic tree of inferred amino acid sequences was also
constructed by neighbor-joining method with the distance matrix calculated using
PROTDIST by Jones-Taylor-Thornton model (91). The bootstrap values were calculated to
evaluate the branching reliability of trees from a consensus tree constructed by generating
1,000 random data sets using SEQBOOT (45). C. trachomatis strain D/IC-Cal-8 (accession
no. X62920) was used as out-group.
![Page 21: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/21.jpg)
16
RESULTS
The epizootiological and genetic data were analyzed to identify the chlamydial
genotypes prevalent among different avian species kept or living in different habitats and
having variable disease manifestations. Out of 1,147 samples screened, 68 (5.93%) were
found positive by the nested PCR among clinically normal, sick and dead birds of all avian
species (Table 3). By sequencing and analyzing the genetic composition of VD2 region of
ompA gene, genetic diversity and phylogenetic relationship among detected strains of
chlamydiae was examined.
Genetic variation and relative prevalence of chlamydial species and strains:
The genetic analysis of VD2 region of ompA genes from 68 samples showed prevalence of
64 C. psittaci (94.12%), 3 C. abortus (4.41%) and 1 unknown type of Chlamydophila sp.
(1.47%) among all avian species (Table 3).
Table 3. Prevalence of chlamydiae according to the sampling sources and clinical status of the host avian
species.
Source Clinical status wise prevalence rate Overall Chlamydial
positive species
(sample no.)
Normal Sicka Dead
Vet. hospitals 2/93 (2.15%)b 7/48 (14.58%) 2/5 (40%) 11/146 (7.53%) C. psittaci (11)
Pet shops 30/564 (5.32%) 0/3 (0%) 1/2 (50%) 31/569 (5.45%) C. psittaci (31)
Bird parks and 6/127 (4.72%) 0/24 (0%) 12/21 (57.14%) 18/172 (10.46%)c C. psittaci (17)
zoos C. abortus (1)
Bird sanctuaries 8/254 (3.14%) 0/3 (0%) 0/3 (0%) 8/260 (3.08%) C. psittaci (5)
and wild fauna C. abortus (2)
Unknown
Chlamydophila
species (1)
Total 46/1038 (4.43%) 7/78 (8.97%) 15/31 (48.39%) 68/1147 (5.93%)
a Indicate the birds showing the chlamydia specific or unrelated clinical signs.
b The figures are positive samples/total tested samples. The positive percentage is shown in parentheses.
c Includes samples of two outbreaks of avian chlamydiosis.
![Page 22: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/22.jpg)
17
Among sequenced samples, 5 kinds of nucleotide sequences (designated as VD2
sequence types) were detected in VD2 region of C. psittaci ompA gene (Fig. 1 and 2; VD2
sequence types 1, 4, 5, 7 and 8 in Table 4). All detected sequence types of C. psittaci were
grouped into 4 genetic clusters, named from I to IV, based on the genetic distance ! 0.014
(Table 4). The genetic distance was calculated by PHYLIP. The majority of detected
strains belong only to clusters I (57.35%) and II (19.12%) and these strains were detected
mainly among psittacine species and only 2 oriental white storks (Fig. 3). On the basis of
phylogenetic and genetic distance analysis, all the known (from data bank) and detected
strains of C. psittaci were divided into 10 genetic clusters (named I to X) (Table 4 and Fig.
4).
The nucleotide and amino acid sequence based percent identity matrix (Table 5)
showed that all the detected and known strains of C. psittaci can be broadly divide into two
large groups. The first group is represented by the strains of clusters I to III and IX (Table
4). The second group is represented by the strains of clusters IV, V, VI, VII, VIII and X
and also CPX0308 strain (Table 4), those are genetically close to C. abortus (Fig. 4). The
WC and CPX0308 strains appeared to be genetically close to the second group of strains.
WC strain showed 88% amino acid homology with GD strain, whereas, CPX0308 showed
79% nucleotide and amino acid homology with C. caviae-GPIC and C. felis-FP baker
strains, respectively.
Phylogenetic analysis: Nucleotide sequence based neighbor-joining (NJ)
phylogenetic tree showed distinct genetic clustering of C. psittaci strains (Fig. 4). CA0302,
CA0306, CA0307 (Table 4) strains form a cluster along with various strains of C. abortus.
The newly detected strains of clusters III and unknown type of Chlamydophila sp., form
significantly distinct diverging clusters from other strains.
![Page 23: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/23.jpg)
18
Fig. 1. Comparative nucleotide sequence alignment of representative variant strains of C.
psittaci, C. abortus and CPX0308 (detected strains in bold letters) in the VD2 region
(within box) and flanking constant domain region of ompA gene. The representative strains
correspond to each group of strains having 100% nucleotide homology in VD2 region
(designated as VD2 sequence types) as shown in Table 4. The alignment was done by
Genetyx-Mac, version. 13.0.6.
![Page 24: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/24.jpg)
CP0312 1 CTTCGACATTTTCTGCACCTTAGGGGCATCCAATGGATACTTCAAAGCAAGTTCGGCTGCATTCAACTTGGTTGGGTTAATAGGGTTTTCAGCTGCAAGCTCA 103GV 1 ...........A........................................................................................... 1036BC 1 ....................................................................................................... 103CP0435 1 ..............................................T...............................................A.C.A.... 103CP0436 1 ..............................................T...............................................A.C.A.... 103MN 1 ..............................................T...............................................A.C...... 103CP0309 1 ........................A.....................................................................A...C.... 103M56 1 ......T.................A.............................T..C....................................T.....G.. 103CP0303 1 ...T..T...........A.....C..T..T.....G...........T.....T..G.........C.C.....T..G..T..TC..AA..GAA.TGAT.TC 101CA0302 1 ...T..T...........A.....C..T..T.....G...........T.....T..G.........C.C.....T..G..T..TG..AA..GAT.CTC.AT. 103VS225 1 ...T..T...........A.....T..T........G...........T.....T............C.C.....T..G..T..TG..AA..GAA.CTC.GT. 103R54 1 ...T..T...........A.....C..T..T.....G...........T.....C..G.........C.C..C..A..G..T..TG..AA..GA..CTCT.T. 10384/2334 1 ...T..............A.....C..T..T.....C...........T.....C..G........TC.C..C..T..G..T..TA..AA..GAAAC.C..T. 103GD 1 T..T..T...........A.....C..T..T.....G...........T.....T..G........TC.C.....T..G..T..TG..AA..GA---.....C 100WC 1 ...T..T...........A.....T..T..T.....C........G.G......C.....T.....TC.T.....C..GT.C..AA..G.T.GA---..TAGC 100CPX0308 1 T.....TG....T.....T.....T..TA.T.....C..T..T...T.T.A...T..A..T..T.GTC.T.....C.....T..AG..G.T.GA.G.TC..T. 103
CP0312 103 ATCTCTACCGATCTTCCAACGCAACTTCCTAACGTAGGCATTACCCAAGGTGTTGTGGAATTTTATACAGACACATCATTTTCTTGGAGCGTAGGTGCACGTGGAG 209GV 103 .......................................................................................................... 2096BC 103 ...................T...................................................................................... 209CP0435 103 .C.................T...................................................................................... 209CP0436 103 .C...........C.....T...................................................................................... 209MN 103 .C.........G.......T...................................................................................... 209CP0309 103 .C........................................................................................................ 209M56 103 G.TAG..............A.................C............................................................C....... 209CP0303 101 .AT---.ATC.A......------------.......C...C........C.....T..G.....C.........A....C...........G............. 194CA0302 103 GCAG..GATC.G.....C------------..T........C..T.....AA.C..T..............T...A....C........T...........C.... 197V225 103 GCAG..GATC.A......------------...........C..T......A....T..G.....C.....T...A....C.......................T. 197R54 103 TCA---GAGC.A......------------...........C..T...........T..G.....C.....T...A...................C.....C.... 19484/2334 103 .CAAA.GA.CGA.....C------------...........C..T.....C.....T..G.....C.....T...A....C....................C.... 197GD 100 T.AA.A.AT..C---------........C.......C...C..T.....C.....T..G.....C.....T...A.G..C......................... 197WC 100 GAAAG..AT.C....AATGAC........A.......CT..C..A.....AA.C..T..G.....C.....T..CA....C...........G........C.... 206CPX0308 103 .ATG...AT..A.....T------------......TT...G..A......A....A..GC....C..T......A....C...........T............. 197
Variable domain 2 Constant domain
Constant domain Variable domain 2
![Page 25: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/25.jpg)
Constant domain Variable domain 2 Constant domain
CP0312 1 FDIFCTLGASNGYFKASSAAFNLVGLIGFSAASSISTDLPTQLPNVGITQGVVEFYTDTSFSWSVGARG 69 GV 1 ...Y................................................................. 69 6BC 1 ........................................M............................ 69 CP0435 1 ...............S...............TN.T.....M............................ 69 CP0436 1 ...............S...............TN.T.....M............................ 69 MN 1 ...............S...............T..T..E..M............................ 69 CP0309 1 ...............................TT.T.................................. 69 M56 1 ...............................S.AV.....K.....A...................... 69 CP0303 1 ............................LKGTDFN-NQ..----..A............T......... 64 CA0302 1 ............................VKGS.IAADQ..----.......I.......T......... 65 VS225 1 ............................VKGT.VAADQ..----.......I.......T......... 65 R54 1 ............................VKG..LS-EQ..----...............T......... 64 84/2334 1 ............................IKGNTLTNDR..----...............T......... 65 GD 1 ............................VKGS.LTND----.....A............T......... 65 WC 1 ...............G..........F.IAGN.E-.NA.ND.....A....I.......T......... 68 CPX0308 1 ..V......T.....SN....S......VAGG.LNANE..----..FM...I..L....T......... 65
Fig. 2. Amino acid homology among representative variant strains of C. psittaci, C. abortus and CPX0308 (detected strains in bold letters)
in the VD2 region of ompA gene. The portion within the box represents the genetically variable domain 2 (VD2) flanked by the constant reg-
-ions of ompA gene. Each representative strain corresponds to a group of strains having 100% nucleotide homology in VD2 region as shown
in Table 4. The alignment was done by Genetyx-Mac, version 13.0.6.
![Page 26: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/26.jpg)
Table 4. Clusters of detected and known strains of C. psittaci based on nucleotide sequence similarity in the VD2 region of the ompA gene.
Genetic clusters VD2 Chlamydial
(! 0.014 genetic sequence species
distance) typesa Name No. Name (accession no.) No.
I 1 CP0312b, CP0315, CP0316, CP0317, 39 MN Zhang (AF269281), 90/1051 (AY762608) 2 C. psittaci
CP0318, CP0320, CP0321, CP0322,
CP0323, CP0324, CP0325, CP0326,
CP0327, CP0328, CP0329, CP0330,
CP0331, CP0369, CP0370, CP0371,
CP0372, CP0373, CP0374, CP0375,
CP0376, CP0432, CP0434, CP0448,
CP0449, CP0450, CP0451, CP0452,
CP0453, CP0454, CP0455, CP0456,
CP0457, CP0458, CP0462
2 Not detectedc 6BCb (X56980) 1 C. psittaci
3 Not detectedc GVb (L25437) 1 C. psittaci
II 4 CP0435b, CP0437, CP0438, CP0439, 11 CP3 (AF269265), 41A12 (AY762609) 2 C. psittaci
CP0440, CP0441, CP0443, CP0444,
CP0445, CP0446, CP0447
5d CP0436b, CP0442 2 Not reportede 0 C. psittaci
6 Not detectedc MNb (AF269262), MNOs (AF269264), 8 C. psittaci
MNRh (AF269263), A22/M (M36703),
WS/RT/E30 (AY762613), 3759/2 (AY762611),
N352 (L04980), 98AV2129 (AY327465)
III 7 CP0309b, CP0311, CP0314, CP0319 7 Not reportede 0 C. psittaci
CP0459, CP0460, CP0461
IV 8 CP0303b, CP0304, CP0305, CP0310, 5 NJ1 (AF269266), TT3 (AF269267), 3 C. psittaci
CP0313 7344/2 (AY762610)
V 9 Not detectedc GDb (AF269261), CT1 (AF269260), 3 C. psittaci
Avian type C (L25436)
VI 10 Not detectedc VS225b (AF269259), 7778B15 (AY762612) 2 C. psittaci
VII 11 Not detectedc 84/2334b (AJ310735) 1 C. psittaci
VIII 12 Not detectedc R54b (AJ243525) 1 C. psittaci
IX 13 Not detectedc M56b (AF269268) 1 C. psittaci
X 14 Not detectedc WCb (AF269269) 1 C. psittaci
15 CA0302b, CA0306K, CA0307K 3 B577 (M73036), EBA (AF269256), 9 C. abortus
OCHL196 (AJ004873), BA1 (L39020),
pm326 (AJ004875), LW508 (M73040),
S26/3 (X51859), pm225 (AJ005617),
wt parakeetf
16 CPX0308b 1 Not reportede 0 Unknown
Chlamydophila
species
a Detected or known strains having 100% nucleotide homology in VD2 region of ompA gene are designated as VD2 sequence type.b The representative strains used for analysis in Fig. 1, Fig. 2 and Table 5. c Strains not detected in our study.d Having 1 nucleotide difference in the VD2 as compared to VD2 type 4 sequences but no change in amino acid residue.e Strains not reported in DNA data banks.f The ompA gene of the strain isolated from a diseased parakeet was found 100% homologous to B577 strain (98).
Detected strains Known strains
![Page 27: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/27.jpg)
Table 5. Percentage identity matrix (PIM) of detected strains (representative strains only) and known strains of C. psittaci and C. abortus in VD2 region of ompA gene.
VD2 Genetic
types clusters 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21
1: C. psittaci-CP0312 1 100 100 100 97 97 97 98 94 79 80 79 77 78 77 73 72 70 72 69 68 60
2: C. psittaci-GV 3 99 100 99 97 96 97 98 93 79 79 79 77 78 77 72 72 70 72 68 68 60
3: C. psittaci-6BC 2 99 97 100 98 97 98 98 94 79 80 79 77 78 77 73 72 70 72 69 68 60
4: C. psittaci-CP0435 4 93 91 94 100 100 99 98 92 80 80 79 78 79 77 72 72 70 73 69 67 61
5: C. psittaci-CP0436 5 93 91 94 100 100 99 97 91 80 80 79 78 79 77 72 72 70 73 69 67 61
6: C. psittaci-MN 6 93 91 94 97 97 100 97 92 79 80 79 78 79 77 72 71 69 72 68 66 60
7: C. psittaci-CP0309 7 III 96 94 94 96 96 94 100 93 88 81 79 78 79 78 73 72 70 73 70 69 61
8: C. psittaci-M56 13 IX 93 91 93 90 90 90 91 100 88 80 77 77 75 78 74 72 72 73 71 70 60
9: C. psittaci-CP0303 8 IV 86 83 86 86 86 84 80 79 100 91 91 92 90 88 81 76 78 80 75 71 64
10: C. psittaci-VS225 10 VI 85 83 85 85 85 85 86 83 92 100 92 91 89 97 81 77 75 78 74 69 65
11: C. psittaci-R54 12 VIII 91 89 91 88 88 88 89 86 93 92 100 91 91 92 79 74 74 79 72 69 66
12: C. psittaci-GD 9 V 85 83 85 83 83 83 85 86 95 91 94 100 92 92 81 77 75 76 73 72 64
13: C. psittaci-84/2334 11 VII 83 82 83 82 82 82 83 82 92 88 91 92 100 88 83 73 73 75 71 70 63
14: C. abortus-CA0302 15 - 86 83 86 83 83 83 85 83 90 97 92 92 88 100 79 73 73 76 71 70 63
15: C. psittaci-WC 14 X 79 76 79 79 79 79 79 79 86 86 86 88 86 86 100 76 70 74 73 69 63
16: Unknown type-CPX0308 16 - 71 69 71 72 72 72 71 69 77 78 78 77 74 78 75 100 79 73 71 72 62
17: C. caviae-GPICa - - 73 70 73 73 73 72 75 75 78 79 79 79 74 77 75 74 100 77 70 72 65
18: C. felis-FP Bakera - - 77 73 77 77 77 75 78 77 84 84 80 79 77 82 77 79 78 100 70 70 64
19: C. pneumoniae-CSFa - - 69 65 69 69 69 69 69 70 70 71 72 76 76 73 73 69 66 66 100 70 67
20: C. pecorum-1710Sa - - 66 67 66 68 68 68 68 68 74 72 70 69 69 69 68 74 74 76 69 100 65
21: C. trachomatis-Da - - 57 54 57 57 57 57 57 57 59 59 62 59 61 59 60 64 62 59 64 64 100
a The accession no. of sequences are: C. caviae-GPIC (AF269282), C. felis-FP Baker (AF269257), C. pneumoniae-CSF (AF131889), C. pecorum-1710S (AF269279) and
C. trachomatis-D (X62920). For C. psittaci strains accession no. are shown in Table 4.
The upper right triangular half of the matrix is nucleotide based and lower left triangular half is amino acid based. The bold figures separating two triangular halves indicate the
100% identity based on nucleotide and amino acid sequences. The strains having !90% identity are boxed together in the solid line. The numbers (1 to 21) in the top row
correspond to the respective species/strains listed in the first column. The matrix was constructed by ClustalX (version 1.83). The comparative PIM of C. psittaci strains with
other Chlamydophila species and C. trachomatis infecting mammals and human (non-avian hosts) is also shown.
I
II
![Page 28: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/28.jpg)
23
Fig. 3. Diagram showing the comparative prevalence of chlamydial strains detected in this study.
The types of avian species (psittacine species are members of Cacatuidae and Psittacidae families)
tested chlamydia positive are shown in boxed text near each cluster of strains. Two largest clusters
of C. psittaci strains are cluster I (57.35%) and cluster II (19.12%) respectively.
Epizootiological analysis: The cases of avian chlamydiosis were mainly due to C.
psittaci strains and detected among 58 samples from Psittaciformes birds, 5 from oriental
white storks and 1 from Java sparrow. The C. abortus was detected in 1 budgerigar and 2
oriental white storks samples. One unknown species, CPX0308 was also found in an
oriental white stork imported from Russia to a bird sanctuary in Japan (Table 6). The
strains of cluster I were mainly detected in chlamydiosis cases including 2 outbreaks (Fig.
10 psittacine species,
1 oriental white stork
5 psittacine
species,
1 oriental
white stork
2 oriental
white storks,
2 budgerigars,
1 Java
sparrow
2 oriental white storks,
1 budgerigar
1 oriental white stork
15 psittacine
species,
1 oriental
white stork
![Page 29: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/29.jpg)
24
5). However, other genotypes were also detected occasionally including an outbreak with
strains of cluster III (mixed infection with cluster I strains). The month wise incidence rate
of chlamydiosis due to various genotypes during 2003 and 2004 is shown in Fig. 5. The
chlamydiosis cases were detected throughout year but slight rise was observed in
chlamydiosis incidences in the beginning of winter and spring seasons including 2
outbreaks.
The prevalence rate according to clinical status, sources of sampling, avian species,
sex, age and geographical locations is as follow:
(i) Clinical status wise prevalence. Among 4.43% (46/1038) clinically normal birds
all 6 types of C. psittaci genotypes (genetic clusters) were detected in the feces including
one case (CP0432) in which only blood sample gave positive PCR result. The strains of
clusters I and II were detected from 8.97% (7 out of 78) sick birds showing chlamydia
specific and non-specific symptoms. 48.39% (15 out of 31) dead birds, those showed
typical clinical symptoms of chlamydiosis before death and histopathological lesions, were
found to carry chlamydial strains of clusters I, II and III (Tables 3 and 6).
(ii) Avian habitat wise prevalence. According to the habitats of avian hosts
(represented by the sources of sampling) that also epitomize managemental conditions and
avian-human interactions, the highest 10.46% cases were detected from bird parks/zoos
(including 2 outbreaks by strains of clusters I and III), followed by 7.53% from
individually/pair wise caged birds, mostly kept as pets in households. However, 5.45% and
3.08% cases were detected respectively from pet shops and bird sanctuaries (Table 3). The
cluster II strains were detected mostly from one pet shop. The strains of cluster I and II
were detected most often among samples from veterinary hospitals and pet shops. The
chlamydial infection in the bird parks and zoos were mostly due to strains of clusters I, III,
and IV of C. psittaci and C. abortus strains, whereas, among samples from bird sanctuaries
![Page 30: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/30.jpg)
25
Fig. 4. Neighbor-joining (NJ) phylogenetic tree, based on nucleotide sequences of VD2
region of ompA gene of different strains of C. psittaci, C. abortus and other
Chlamydophila species. The strains detected in this study are shown in bold letters and
vertical lines mark genetic clusters of C. psittaci strains from I to X. The genetic
distance is indicated in 0.05 unit bar. Bootstrap values are shown at respective nodes.
The C. trachomatis is used as out-group.
![Page 31: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/31.jpg)
WC (AF269269)
B577 (M73036) pmSH1 (AJ005618) pm234 (AJ004874) pmd623 (AJ005615) pm112 (AJ005613)
EBA (AF269256) BA1 (L39020) S26/3 (X51859) LW508 (M73040) pm225 (AJ005617) pm326 (AJ004875) OCHL196 (AJ004873) CA0302 CA0306 CA0307
VS225 (AF269259) 7778B15 (AY762612)
GD (AF269261) CT1 (AF269260) Avian type C (L25436)
84/2334 (AJ310735) NJ1 (AF269266) TT3 (AF269267) 7344/2 (AY762610) CP0303 CP0304 CP0305 CP0310 CP0313
R54 (AJ243525)
C. felis-FP Baker (AF269257)
M56 (AF269268) CP0309 CP0311 CP0314 CP0319
CP3 (AF269265) CP0436 CP0442
41A12 (AY762609) CP0435 CP0437 CP0438 CP0439 CP0440 CP0441 CP0443 CP0444 CP0445 CP0446 CP0447 MN (AF269262) MNOs (AF269264) MNRh (AF269263)
GV (L25437)
A22/M (M36703) N352 (L04980) 3759/2 (AY762611) WS/RT/E30 (AY762613) 98AV2129 (AY327465)
6BC (X56980)
CP0359 CP0360 CP0361
CP0312 CP0315 CP0316 CP0317 CP0318 CP0320 CP0321 CP0322 CP0323 CP0324 CP0325 CP0326 CP0327 CP0328 CP0329 CP0330 CP0331 CP0369 CP0370 CP0371 CP0372 CP0373 CP0374 CP0375 CP0376 CP0432 CP0434 CP0448 CP0449 CP0450
CP0452 CP0453 CP0454 CP0455
90/1051 (AY762608) MN Zhang (AF269281)
CP0456 CP0457 CP0458 CP0462
C. caviae-GPIC (AF269282) CPX0308
C. pneumoniae-CSF (AF131889)C. pecorum-1710S (AF269279)
C. trachomatis-D/IC-Cal-8 (X62920)
C. a
bort
us
I
II
III
IV
100%
100%
99.9%
100%
95.5%
90.5%
79.4%
0.05 units
CP0451
V
VI
VII
VIII IX
X
![Page 32: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/32.jpg)
Fig. 5. Month wise incidences of avian chlamydiosis cases detected by PCR during 2003 and
2004 among all avian species. The numerical figures shown inside and above the bars are actu-
-al numbers of chlamydiae positive and negative cases. The numbers shown in columns below
each bar indicatethe distribution of samples and detected strain type in each month. Outbreak-I
and outbreak-II took place at two different bird parks and boxes mark the types of C. psittaci
strains involved.
I. 0 0 1 0 0 1 3 1 6 7 8 8 1 1 0 0 0 0 1 0 0 0 1 0
II. 0 0 0 0 0 0 0 0 0 0 0 0 0 2 11 0 0 0 0 0 0 0 0 0
III. 0 0 3 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 3 0
IV. 0 3 1 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
Genetic clusters
(2004)(2003)
outbreak-I
outbreak-II
Sam
ple
num
ber
0
62
40
5951
27
60
36
6574
37
140
4136
151
32
18
47
9 1217
54
0
0
1
1
11
0
0
0
1
00
0
47
4
11
8
3
9
7
6
3
6
6
0
0
20
40
60
80
100
120
140
160
180
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec
Sample numbers
Positive
Negative
Number of samples
C. psittaci
C. abortus
Unknown
Chlamydophila sp.
![Page 33: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/33.jpg)
28
strains of clusters I, III, IV and unknown type of the Chlamydophila sp. were detected
(Table 6).
(iii) Avian species wise prevalence. The incidences of chlamydiosis were
predominantly detected among Psittaciformes birds (detected among 28 psittacine avian
species). It includes chlamydia positive rates of 7.61% (14 out of 184) in family
Cacatuidae and 7.23% (45 out of 622) in family Psittacidae. However, some psittacine
bird species such as Trichoglossus haematodus 12 out of 52 (23.08%), Nymphicus
hollandicus 11 out of 77 (14.28%), Aratinga sp. 5 out of 44 (11.36%), Ara sp. 5 out of 55
(9.09%) and Mesopsittacus undulates 5 out of 59 (8.47%) showed high incidences (Tables
1, 2 and 6). In the Cacatuidae family mainly the cluster I strains were detected; however,
in Psittacidae, strains of clusters I, II, III, IV and C. abortus were detected. Whereas,
among non-psittacine species, 3.12% (8 out of 256) samples from oriental white storks
(Ciconia boyciana) belonging to Ciconiidae family of order Ciconiiformes, were found
having strains of clusters I, II, III, IV, C. abortus and unknown type of Chlamydophila sp.
A single case of chlamydiosis due to a strain of cluster IV was also detected in a Java
sparrow (Padda oryzivora) belonging to Estrildidae family of Passeriformes order (Table
6).
(iv) Avian sex and age wise prevalence. The incidences of chlamydiosis were found
higher among birds around the age group of 3 months due to different genotypes,
irrespective of their sexes (Table 6).
(v) Worldwide locations wise prevalence. All type of genotypes were detected
among the avian species imported to Japan from Singapore, Indonesia, USA, South Africa
and Russia as well as from different places in Japan, indicating ubiquitous presence of
various chlamydia genotypes infecting different avian fauna (Table 6).
![Page 34: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/34.jpg)
Table 6. Types of chlamydial species/strains detected in relation to the zoological position, sampling source, clinical status, sex, age and import source of avian host species
Gen-
Order, family and scientific name (common name) Species wise Strains etic Accession no.
of the host avian species positive/tested No. Type Clinical history Source Age:sex of the hosta Source of Chlamydial designated clust-
(no. of positive/tested samples) samples (M: male, F: female) importb species ters
Order-Psittaciformes (59/806)
Family-Cacatuidae (14/184)
Cacatua moluccensis (Salmon-crested Cockatoo) 1/18 1 Clotted blood Normal Pet shop 6 months Singapore C. psittaci CP0432 I AB239867
C. sulphurea (Yellow-crested Cockatoo) 1/26 1 Cloacal swab Normal Pet shop Indonesia C. psittaci CP0457 I AB239878
Eolophus roseicapillus (Roseate Cockatoo or Galah) 1/9 1 Pooled visc. orgn.c Dead (outbreak-I)d Bird park/zoo C. psittaci CP0312 I AB239842
Nymphicus hollandicus (Cockatiel) 11/77 2 Feces Normal Vet. Hospital 3 months C. psittaci CP0315 I AB239843
C. psittaci CP0316 I AB239844
4 Feces Sicke Vet. Hospital 6 months C. psittaci CP0322 I AB239848
2 years 10 months C. psittaci CP0460 III AB239897
C. psittaci CP0448, CP0449 I AB239869, AB239870
5 Cloacal swabs Normal Pet shop Domestically C. psittaci CP0451, CP0452 I AB239872, AB239873
bred (Japan) CP0453, CP0454 AB239874, AB239875
CP0455 AB239876
Family-Psittacidae (45/622)
Amazona aestiva (Blue-fronted Amazon) 1/6 1 Feces Sicke Vet. hospital 1 year C. psittaci CP0462 I AB239880
Ara ararauna (Blue-and-yellow Macaw) 1/11 1 Cloacal swab Normal Pet shop C. psittaci CP0444 II AB239888
A. auricollis (Yellow-collard Macaw)* 2/23 2 Cloacal swabs Normal Pet shop 2 years Singapore C. psittaci CP0445, CP0446 II AB239889, AB239890
A. severa (Chestnut-fronted Macaw)* 2/7 2 Pooled visc.orgn.c Dead (outbreak-I)d Bird park/zoo C. psittaci CP0311, CP0314 III AB239893, AB239894
Aratinga aurea (Peach-fronted Conure) 1/3 1 Cloacal swab Normal Pet shop 1 year:F South Africa C. psittaci CP0328 I AB239855
A. pertinax (St. Thomas/Brown-throated Conure)* 1/1 1 Cloacal swab Normal Pet shop 1 year:M South Africa C. psittaci CP0329 I AB239856
A. acuticaudata (Blue-crowned Conure) 1/7 1 Cloacal swab Normal Pet shop South Africa C. psittaci CP0330 I AB239857
A. wagleri (Scarlet or Red-fronted Conure)* 1/2 1 Cloacal swab Normal Pet shop M South Africa C. psittaci CP0439 II AB239884
A. jandaya (Jandaya Conure)* 1/6 1 Cloacal swab Normal Pet shop 3 months South Africa C. psittaci CP0442 II AB239908
Lorius lory (Black-capped Lory)* 1/5 1 Cloacal swab Normal Pet shop 1 year Singapore C. psittaci CP0441 II AB239886
Melopsittacus undulatus (Budgerigar) 5/59 1 Feces Normal Bird park/zoo C. abortus CA0302 - AB239904
2 Feces Normal Bird park/zoo C. psittaci CP0303, CP0304 IV AB239899, AB239900
1 Spleen Dead Vet. hospital 4 months C. psittaci CP0447 II AB239891
1 Liver Dead Vet. hospital C. psittaci CP0438 II AB239883
Neophema bourkii (Bourke's Parrot) 1/2 1 Feces Sicke Vet. hospital 6 months:M C. psittaci CP0458 I AB239879
Poicephalus rueppellii (Rüppell's Parrot)* 2/7 2 Cloacal swabs Normal Pet shop M South Africa C. psittaci CP0326 I AB239853
South Africa C. psittaci CP0450 I AB239871
P. senegalus (Senegal Parrot) 1/42 1 Cloacal swab Normal Pet shop 3 months South Africa C. psittaci CP0319 III AB239895
P. cryptoxanthus (Brown-headed Parrot)* 2/26 1 Cloacal swab Normal Pet shop 3 months:M South Africa C. psittaci CP0323 I AB239850
1 Cloacal swab Normal Pet shop 3 months:M South Africa C. psittaci CP0436 II AB239907
P. meyeri (Meyer's Parrot/Broun Parrot) 1/19 1 Cloacal swab Normal Pet shop 3 months:M South Africa C. psittaci CP0435 II AB239881
Details about the PCR positive and sequenced samples
![Page 35: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/35.jpg)
P. gulielmi (Red-crowned/Jardine's Parrot) 1/23 1 Cloacal swab Normal Pet shop South Africa C. psittaci CP0443 II AB239887
Pionites leucogaster (White-bellied Caique) 1/8 1 Pooled visc.orgn.c Dead f Pet shop 3 months:M USA C. psittaci CP0461 III AB239898
P. melanocephala (Black-headed Caique) 1/6 1 Cloacal swab Normal Pet shop C. psittaci CP0456 I AB239877
Psittacula derbiana (Derbyan Parakeet) 1/3 1 Cloacal swab Normal Pet shop Domestically C. psittaci CP0327 I AB239854
bred (Japan)
Psittacus erithacus (African Grey Parrot) 3/154 3 Cloacal swabs Normal Pet shop 3 months:M South Africa C. psittaci CP0317, CP0318 I AB239845, AB239846
3 months South Africa C. psittaci CP0434 I AB239868
Pyrrhura hypoxantha sallvadori (Yellow-sided Conure)* 1/3 1 Cloacal swab Normal Pet shop 5 months C. psittaci CP0440 II AB239885
P. perlata lepida (Pearly Conure)* 1/5 1 Feces Sickg Vet. hospital 1 year 9 months:M C. psittaci CP0459 III AB239896
Trichoglossus haematodus (Green-napped Lorikeet) 1+11h/49 8 Pooled visc. Orgn.c Dead (outbreak-II)h Bird park/zoo C. psittaci CP0320, CP0369 I AB239847, AB239859
CP0370, CP0371 AB239860, AB239861
CP0373, CP0374 AB239863, AB239864
CP0375, CP0376 AB239865, AB239866
1 Feces Dead (outbreak-II)h Bird park/zoo C. psittaci CP0324 I AB239851
2 Feces Normal (outbreak-II)h Bird park/zoo C. psittaci CP0321, CP0372 I AB239849, AB239862
1 Cloacal swab Normal Pet shop M C. psittaci CP0325 I AB239852
Order-Ciconiiformes (8/257)
Family-Ciconiidae (8/256)
Ciconia boyciana (Oriental White Stork)* 8/256 2 Feces Normal Bird sanctuary Russia C. abortus CA0306, CA0307 - AB239905, AB239906
1 Feces Normal Bird sanctuary Russia Unknown CPX0308 - AB239931
Chlamydo-
phila sp.
3 Feces Normal Bird sanctuary Russia C. psittaci CP0309 III AB239892
Russia C. psittaci CP0331 I AB239858
Russia C. psittaci CP0437 II AB239882
2 Cloacal swabs Normal Bird sanctuary Russia C. psittaci CP0310, CP0313 IV AB239902, AB239903
Order-Passeriformes (1/13)
Family-Estrildidae(1/5)
Padda oryzivora (Java Sparrow) 1/5 1 Feces Normal Bird park/zoo C. psittaci CP0305 IV AB239901
a Only the available data about age and sex of avian species are shown.b Only the confirmed records about the source of importation and breeding place of host species are shown.c Pooled visceral organs includes pieces lung, liver, spleen and heart.d Samples are from outbreak-I.e Include those birds showing chronic weight loss, yellowish-green diarrhea, anorexia, cachexia and rise in body temperature.f Died with acute symptoms and also found positive for avian polyoma virus by PCR.g Had crop inflammation due to yeast infection along with clinical symptoms of chlamydiosis. h Samples from outbreak-II.
* The avian species detected chlamydia positive first time when compared to referred latest updated list (94).
![Page 36: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/36.jpg)
31
DISCUSSION
C. psittaci mainly infects avian species and also has potential zoonotic importance
(8, 181, 188). In this chapter, we investigated the strain level prevalence of various
chlamydiae among diverse avian fauna and examined various situations those contribute to
the maintenance, precipitation and/or horizontal transmission of infection. Further genetic
and phylogenetic relationships among prevalent species/strains were also examined.
We analyzed partial ompA gene (VD2 region) for identification of chlamydial
species and strains. This locus has been reported to be associated with the phylogenetic
divergence of Chlamydophila spp. and Chlamydia spp. and has been used in other
phylogenetic studies. Although the phylogenetic analyses of conserved 16S rRNA, ompA
and rnpB genes of chlamydiae group are often used to classify and differentiate C. psittaci
strains from other species of family Chlamydiaceae (60, 79, 149, 191, 193, 205), the
analysis of ompA gene is advantageous in epizootiological strain typing due to presence of
strain/serovar/genotype specific motifs in 4 genetically variable domains (12, 86, 148,
225). Sequence analysis of highly conserved 16S rRNA gene may not detect minor strain
variations. Direct sequencing of 16S rRNA gene was also not suited in our study due to the
interference by normal intestinal microflora DNA as we tested many samples of fecal/fecal
swab or intestinal loops origin. By our approach, small DNA fragment of ompA gene can
be conveniently amplified from clinical samples by nested PCR and sequenced even in
lower EB concentration in samples (2 to 10 EBs). This approach of direct strain typing
from clinical samples particularly in large-scale epizootiological/epidemiological studies is
less cumbersome as serotyping and isolation is time consuming.
To survey the host range of C. psittaci, total 113 avian species from 11 avian orders
examined. The chlamydiae were detected among 28 species of psittacine birds and 2
species of non-psittacine birds (oriental white stork and Java sparrow). Out of total 28
![Page 37: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/37.jpg)
32
psittacine bird species 10 were detected first time to harbor chlamydiae in this study along
with 1 oriental white stork species (Table 6). Till date the chlamydiae have been detected
among 460 avian species from 30 avian orders that include 153 Psittaciformes species
(94). Therefore, the chlamydiae have been detected among 163 (47.66%) out of total 342
Psittaciformes species prevalent worldwide including results of present study. Some
species popularly kept as pets such as Trichoglossus haematodus (Green-napped Lorikeet),
Nymphicus hollandicus (Cockatiel), Aratinga sp. (Parakeet or Conure), Ara sp. (Macaw)
and Mesopsittacus undulates (Budgerigar) showed exceptionally high incidences of
chlamydiosis. From the results of this study and earlier reports those documented high
chlamydiosis incidences among Psittaciformes species (18, 69) it appears that
Psittaciformes are predominant reservoirs of chlamydiae among all avian species.
Therefore, Psittaciformes avian species may be responsible for maintenance or
transmission of infection in the population.
Although there are many reports regarding the pigeons as natural carriers of C.
psittaci and source of infection to human being (6, 16, 20, 45), in this study only few
samples from pigeons were tested, those were found negative. As the main thrust of this
study was analyzing samples from captive avian fauna, either imported or indigenously
bred and kept under near natural or caged conditions and are often exposed to human
beings and animal fauna.
C. psittaci strains are divided into 8 serotypes named A to H (4, 56, 206, 207) and 7
genotypes from A to F and E/B (60, 174, 207), based on monoclonal antibody typing and
AluI RFLP pattern of ompA gene respectively. In the present study, clustering pattern of C.
psittaci strains in relation to grouping on the basis of serological and RFLP studies was
also analyzed phylogenetically using nucleotide sequences and deduced amino acid
sequences as described in materials and methods. Genetic cluster I includes C. psittaci
![Page 38: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/38.jpg)
33
strains with ompA gene AluI RFLP pattern and serotype type A; clusters II includes RFLP
types B, E and E/B and serotype types B and E; cluster IV includes RFLP and serotype
type D; whereas, strains of cluster III and CPX0308 are unknown types.
The genetic and phylogenetic analysis of chlamydial strains detected in the
screened avian fauna revealed that VD2 sequence type 1 and 4 form clusters I and II along
with genetically related strains classified as serovars/genotypes-A and B by others (4, 174).
Clusters I and II were found predominantly prevalent especially among Psittaciformes
birds. High prevalence of serotypes/genotypes A and B have also being reported in recent
studies (60, 191, 207).
Cluster III strains were also detected from 6 psittacine birds and 1 oriental white
stork. Cluster III strains have 3 amino acid substitutions in VD2 region as compared to
VD2 sequence types 1 and 4 clusters of strains. Cluster III strains appeared to be recently
evolved from cluster II strains.
Strains of cluster IV which are genetically the same as serovar/genotype-D strains
of C. psittaci (4, 60, 174) were detected from 2 oriental white storks, 2 budgerigars and 1
Java sparrow. These strains were usually detected from non-psittacine avian species and
are highly pathogenic to domesticated poultry (4, 7, 8, 207). Our results indicate that these
strains may have broad host range and may dormantly exist among other free-living avian
fauna those can be potential source of infection to domesticated/commercial poultry.
CA0302, CA0306 and CA0307 strains detected from 3 samples, genetically
resembled to a cluster of C. abortus strains. Similarly a “wt parakeet” strain, isolated from
a diseased parakeet by Kaltenboeck et al. (96), was found to have ompA gene sequence
100% homologous to that of B577 strain of C. abortus (98). The genetic data based on
RFLP pattern and 16S rRNA and 16S-23S rRNA inter genic spacer region sequencing
studies have also indicated that the genetic relatedness among C. psittaci and C. abortus is
![Page 39: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/39.jpg)
34
quite high and there are some isolates having the characteristic of both groups (43, 51, 149,
193, 205). Recent studies have also pointed toward this fact (191). The C. abortus seems to
be latest diverging group still having genetic roots in the avian hosts.
From the epizootiological and genetic data of this study and other reports, it can be
inferred that all chlamydial strains responsible for avian chlamydiosis can be broadly
divided into two groups: major C. psittaci strains and minor C. psittaci strains. The major
group includes those strains which are highly prevalent among avian species, evolutionally
conserved and are genetically adapted to class aves. The examples are strains of clusters I,
II, III and IV (Tables 4 and 5) and serovar/genotypes-A, B, C, D, E and E/B (4, 56, 60,
206, 207). Whereas, the minor group include very rarely detected strains among avian and
mammalian species and genetically intermediate between other mammalian
Chlamydophila species and C. psittaci such as strains of CA0302, CA0306 and CA0307
strains and unknown type of Chlamydophila sp. (CPX0308 strain) (Tables 4 and 5) and
serovar-F, G, H and 84/2334, VS225 strains (4, 56, 206, 207) and R54 strain (79), V448,
V351 strains (191) and Daruma strain (51).
Finally, it can be concluded that incidences of avian chlamydiosis are more among
psittacine birds especially under captive conditions. Though disease incidences are high in
some avian species but the C. psittaci is maintained and propagated in the population by a
large variety of inapparently infected avian fauna. Many strains of C. psittaci are
genetically well adapted to avian fauna and associated with disease or simply co-exist in
dormant stage but only some of the strains are predominantly prevalent among birds.
![Page 40: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/40.jpg)
35
SUMMARY
For studying the genetic diversity and occurrence of Chlamydophila psittaci, a total
of 1,147 samples from 11 avian orders including 53 genera and 113 species of feral and
captive birds were examined using ompA gene based nested PCR. Three types of
chlamydiae: C. psittaci (94.12%), C. abortus (4.41%) and unknown Chlamydophila sp.
(1.47%) were identified among 68 (5.93%) positive samples (Psittaciformes-59,
Ciconiiformes-8 and Passeriformes-1). On the basis of nucleotide sequence variations in
the VD2 region of ompA gene, all 64 detected C. psittaci strains were grouped into 4
genetic clusters. Clusters I, II, III and IV were detected from 57.35%, 19.12%, 10.29% and
7.35% samples respectively. A single strain of unknown Chlamydophila sp. was found to
be phylogenetically intermediate between Chlamydophila species of avian and mammalian
origin. Among Psittaciformes, 28 out of 81 tested species including 10 species previously
unreported were found chlamydiae positive. Chlamydiosis was detected among 8.97% sick
and 48.39% dead birds as well 4.43% clinically normal birds. Therefore, it was concluded
that, though various genetically diverse chlamydiae may have caused avian chlamydiosis,
only a few C. psittaci strains were highly prevalent and frequently associated with
clinical/subclinical infections.
![Page 41: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/41.jpg)
36
Analysis of genetic diversity and molecular phylogeny of the Chlamydophila
psittaci strains prevalent among avian fauna and associated with human
psittacosis.
INTRODUCTION
Chlamydophila psittaci is an obligate intracellular pathogen, mainly causing
clinical or subclinical infections among avian species and is also potentially pathogenic to
other mammals and human beings (8, 181). The disease of avian species is called “avian
chlamydiosis” and human infection is known as “psittacosis” (181). The clinical avian
chlamydiosis is either acute or subacute and characterized by respiratory distress, diarrhea,
ocular and nasal discharge, nervous signs or systemic infection with varying severity and
mortality up to 30% (8). The infectious elementary bodies (EBs) of C. psittaci can survive
for months in feces and secretions in the environment and human get infection by inhaling
air borne infectious particles (181).
Avian chlamydiosis has been reported from 471 avian species but mainly from
psittacine birds (33, 94). Human infections are typically acquired from exposure to pet
psittacine birds, however, infection from poultry, free ranging birds have also been
reported (9, 113, 127, 197). The morbidity and mortality among the infected populations is
attributed to many factors. In human psittacosis, a wide spectrum of illness is possibly
ranging from asymptomatic infection to mild influenza-like illness to a fulminate disease
with involvement of several extra pulmonary sites (67, 181).
Attempts have been made in past to serotype or biotype C. psittaci strains of avian
origin by using polyclonal sera, plaque reduction neutralization, microimmunofluroscence
CHAPTER-II
![Page 42: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/42.jpg)
37
and examining inclusion morphology (11, 183). Biological difference has also been
observed among various C. psittaci strains. Two different nucleic acid precursor utilization
patterns and variation in susceptibility to sulfonamides and 5-fluorouridine were observed
(125). Winsor and Grimes also divided 17 C. psittaci strains into low infective and high
infective groups on the basis of infectivity and cytopathology to L929 cells (219). These
biological differences are also well supported by later genetic studies based on gene
specific or whole genome restriction endonuclease analysis and DNA-DNA hybridization
(3, 6, 51, 126, 200).
After the reclassification of order Chlamydiales on the basis of the 16S rRNA gene,
all the avian and 2 mammalian origin strains of the old Chlamydia psittaci group are now
classified as Chlamydophila psittaci (43). Alternatively, ompA gene that encodes major
outer membrane protein (MOMP), which is immuno dominant, is used for serotyping and
genotyping of the C. psittaci strains in epidemiological studies. Various C. psittaci strains
are classified into 8 serovars from A to H using MOMP specific monoclonal antibodies
(Mab) (4, 56, 206, 207) and into 7 genotypes on the basis of the AluI restriction fragment
length polymorphism (RFLP) of the ompA gene (60, 174, 207). But the recent
epidemiological studies and some previous reports have shown the existence of genetically
diverse strains among avian fauna (33, 51, 79, 191, 205). The phylogenetic positions of
these strains have not been established yet. Though the host specificity of different C.
psittaci serotypes and genotypes has been reported (7), but their prevalence across many
avian/mammalian species has been detected (33, 174, 207). Therefore, it is imperative to
genetically characterize all the genetically variant C. psittaci strains irrespective of host
species and to design a suitable and more accommodative classification scheme. Further
identification of C. psittaci strains with higher potential for transmitting and causing
infection of human and other mammalian livestock is also needed.
![Page 43: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/43.jpg)
38
Therefore, in this chapter, diverse C. psittaci strains detected from various avian
and mammalian hosts including human beings were genetically analyzed in ompA gene
locus to know the phylogenetic relationships, pathobiotic implications and for improved
strain categorization. C. psittaci strains with the histories of causing human psittacosis are
either isolated/detected directly from clinically sick patients or from in-contact avian hosts.
Phylogenetic positions of highly diverse strains were confirmed by additionally analyzing
the16S rRNA gene. It was observed that all the genetically diverse C. psittaci strains could
be grouped into 4 broad lineages and 8 small genetic clusters, which encompass all the 7
known and 4 new genotypes as well as all 8 known serotypes. The majority of C. psittaci
strains responsible for the human infection belongs to genetic cluster I.
MATERIALS AND METHODS
Chlamydial species and strains: The C. psittaci strains used for genetic analysis
are listed in the Table 7 along with brief historical background. The C. psittaci strains with
the history of human psittacosis includes those isolated in Japan in last 40 years and those
available in DNA data banks.
Chlamydial culture and purification of EBs: McCoy cell lines were used for
primary isolation and multiplication of new and laboratory strains of C. psittaci. The cells
were maintained in Eagle’s minimum essential medium-1 (MEM-1) (Nissui, Japan)
containing 5% fetal bovine serum (FBS), 10 µg/ml gentamicin and 1 µg/ml of
cycloheximide. The EBs were harvested 3 to 4 days after inoculation. Chlamydial EBs
were partially purified as reported by Tamura and Higashi (194). Briefly, harvested cell
suspension was centrifugation at 1,000 ! g for 10 min at 4°C to remove cell debris. The
supernatant was then again centrifuged at 12,000 ! g for 60 minutes at 4°C. The pellets
![Page 44: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/44.jpg)
39
Table 7. C. psittaci strains used to study ompA gene.
Strains Source Human Geographical Reference Data bank
(sample type) infection location accession no.
N-1 Budgerigar (fecal swab) Psittacosisa Japan This study AB284055
Itoh Human (blood and sputum) Psittacosisb Japan This study
c AB284056
Izawa-1 Budgerigar (feces) Psittacosisa Japan This study
d AB284057
Mat116 Chestnut-fronted Macaw (feces) Psittacosish Japan This study AB284058
CP0315 Cockatiel (feces) Psittacosisa Japan This study AB284059
Nosé Budgerigar (feces) Psittacosisa Japan This study
d AB284060
30A Human (ear swab Psittacosisb Japan This study
c, d AB284061
KKCP1 Human (nasopharyngeal swab) Psittacosisb Japan This study
d AB284062
KKCP2 Human (bronchoalveolar fluid) Psittacosisb Japan This study
d AB284063
CPX0308 Oriental White Stork (feces) Unknown Japan This study AB284064
Daruma Parakeet (viscera) Unknown India This studyg AB284065
Borg Human (lung) Pneumonitisb USA This study
e AB284066
6BC Parakeet Unknownf USA (42) M73035
MN Zhang Human/ferret Psittacosisb USA (49) AF269281
CP3 Pigeon Unknown USA (145) AF269265
TT3 Turkey Psittacosis h USA (144) AF269267
NJ1 Turkey Psittacosish USA (142) AF269266
MN/Cal10 Human/ferret Psittacosisb
USA (49) AF269262
MNOs Ostrich Unknown USA (5) AF269264
MNRh Rhea Unknown USA (5) AF269263
WC Bovine (intestinal tissues) Psittacosish
USA (143) AF269269
VS225 Orange-fronted Parakeet Unknown USA (24) AF269261
CT1 Turkey Unknown USA (141) AF269260
41A12 Wild turkey Unknown Belgium (60) AY762609
7778B15 Wild turkey Unknown Belgium (60) AY762612
90/1051 Amazon parrot Unknown Belgium (60) AY762608
92-1293 Turkey Unknown Belgium (208) Y16562
84-55 Parakeet Unknown Belgium (208) CPS16561
98AV2129 Swine Unknown Belgium (211) AY327465
84/2334 Amazon parrot (lung) Unknown Germany (205) AJ310735
GD Duck Unknown Germany (88) AF269261
WS/RT/E30 Duck Unknown Germany (60) AY762613
A22/M Sheep Unknown UK (147) M36703
N352 Duck Unknown UK (157) L04980
Avian type C Unknown avian sp. Unknown UK Storey (1994)j L25436
GV Goat (vaginal sample) Unknown UK Storey (1994)j L25437
7344/2 Pigeon Unknown Italy (60) AY762610
3759/2 Pigeon Unknown Italy (60) AY762611
M56 Muskrat Unknown Canada (182) AF269268
R54 Brown skua (feces) Unknown Sub Antarctic (79) AJ243525
Island
Fulmar#10 Fulmar (cloacal sample) Unknown Faroe Islands (78) AM050561
05/02 Human Psittacosisi Netherlands Heddema et al. 2005)
j DQ324426
OSV Human (sputum/throat wash) Psittacosisi Netherlands (77) DQ230095
CLV Pigeon Unknown Netherlands (77) DQ230096
Orni Pigeon (feces) Unknown Netherlands (76) DQ435299
CLA Pigeon (feces) Unknown Netherlands (76) DQ267973
a Confirmed by detecting chlamydia specific antibodies in psittacosis patients and isolation from companion birds.
b Isolation from human patients having all the typical clinical signs of psittacosis.
c Itoh strain was isolated by Jo et al. 1962 (90) and 30A strain was isolated by Mukai et al. 1985 (134).
d Isolated and kindly provided by Dr. Akira Matsumoto, Kawasaki School of Medicine, Japan (120).
e Isolated by Olson and Treuting, 1944 (ATCC VR-601) (140).
f DNA similar to 6BC (ATCC VR125) was detected in vaginal sample (81).
g Isolated by Yamashita and Hirai, 1981 (221).
h Doubtful history of psittacosis.
i Confirmed by C. psittaci DNA detection in clinical samples of human psittacosis patients.
j Unpublished work.
![Page 45: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/45.jpg)
40
were then resuspended in 0.01M Tris-HCl, pH 7.4, in appropriate volumes and each strain
was stored at -80°C in aliquots. These aliquots were later used for DNA extractions.
DNA extraction: SepaGene DNA extraction Kit (Sanko Junyaku, Tokyo, Japan)
was used to extract DNA from samples according to the manufacturer’s instructions. In
brief, about 100 µl partially purified EB were suspended in 700 µl of phosphate-buffered
saline (PBS), pH 7.4, were processed for DNA extraction. DNA was finally dissolved in
50 µl of Tris-EDTA buffer, pH 7.4 (100 mM Tris-HCl, pH 7.4 and 10 mM EDTA, pH 8.0)
and stored at –30°C. The ompA and 16S rRNA genes were amplified in overlapping
fragments by PCR using pair of forward and reverse primers as shown in Table 8.
PCR amplification: The PCR was done in 50 µl reaction mixture containing 0.15
µM of each forward and reverse primer, 250 µM of each dATP, dTTP, dGTP, dCTP, 100
µM of Mg2+
in buffer and 2.5 units of TaKaRa Ex-Taq (Takara Bio Inc., Shiga, Japan) and
2.0 to 5.0 µg of template DNA of each strain. The thermo cycling conditions were:
denaturation for 3 min at 94°C, then 35 cycles of denaturation for 30 sec at 94°C,
annealing for 30 sec at a temperature depending on melting temperature of forward and
reverse primer pairs and extension at 72°C for 60 sec, then final extension for 5 min at
72°C and soaking at 4°C.
DNA sequencing: The cloning of PCR amplified products was done as described
in CHAPTER-I, i.e. 3 to 5 clones with expected size DNA insert were taken for
sequencing. The sequences were assembled and edited using Genetyx-Mac/ATSQ 4.2.3
and Genetyx-Mac, version 13.0.6 (SDC, Tokyo, Japan).
Phylogenetic analysis: For phylogenetic analysis, all the available ompA gene
sequences of C. psittaci strains and each representative species of genera Chlamydophila
and Chlamydia were retrieved from DDBJ. The ompA and 16S rRNA gene sequences were
trimmed to the uniform length to included all the known, genetically diverse C. psittaci
![Page 46: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/46.jpg)
41
Table 8. Oligonucleotide primers used to amplify ompA and 16S rRNA genes.
Name Sequence Positionsa Tm Size
(°C)b
(bp)
ompA gene
M/0PF 5` GCAAGTATAAGGAGTTATTGCTTG 3` -275 to -252 54-56 352
M/0PR 5` CCTACAGGCAAGGCTTGTAAG 3` 56-77 57-60
M/1PF 5` CGGCATTATTGTTTGCCGCTAC 3` 20-41 59 390
M/1PR 5` CGAAGCGATCCCAAATGTTTAAGGC 3` 409-385 59-61
M/2PF 5` CGCTTACGGAAGGCATATGCAAGATG 3` 330-355 62 397
M/2PR 5` GTGAATCACAAATTGTGCTGGGCT 3` 726-703 58-60
M/3PF 5` CGTGGAGCTTTATGGGAATGTGGTTG 3` 607-632 62 330
M/3PR 5` GAGCAATGCGGATAGTATCAGCATC 3` 937-913 60-62
M/4PF 5` GGCGTAAACTGGTCAAGAGCAAC 3` 886-908 60-62 387
M/4PR 5` TCCCAGGTTCTGATAGCGGGACAA 1272-1246 61-63
16S rRNA gene
CPR/P1F 5` CTGAGAATTTGATCTTGGTTCAG 3` 5-27 54-56 400
CPR/P1R 5` CGCTTCGTCAGACTTTCGTCCATT 3` 404-381 60
CPR/P2F 5` CGTCTAGGCGGATTGAGAGATTG 3` 291-313 60-62 418
CPR/P2R 5` CGCATTTCACCGCTACACGTGGAAT 3` 708-684 60-62
CPR/P3F 5` GCGTGTAGGCGGAAAGGAAAGTT 3` 585-607 60-62 413
CPR/P3R 5` CCAGGTAAGGTTCTTCGCGTTGCAT 3` 997-973 59-61
CPR/P4F 5` CCGTGTCGTAGCTAACGCGTTAAGT 3` 860-884 60-62 444
CPR/P4R 5` GGCTAGCTTTGAGGATTTGCTCCAT 3` 1403-1279 59-61
CPR/P5F 5` CGAGGATGACGTCAAGTCAGCAT 3` 1191-1213 60-62 367
CPR/P5R 5` TGTCGACAA AGGAGGTGATCCAG 3` 1557-1537 55-57
a Based on ompA gene open reading frame (ORF) of C. psittaci-6BC strain (accession no. X56980) and 16S
rRNA gene of C. psittaci-Prk/GCP-1 strain (D85713). The negative values indicate the nucleotide position
upstream of respective ORF. bAverages of melting temperatures of forward and reverse primer sets were used in the PCR amplifications.
strains. A total of 1,492 bp fragment of 16S rRNA was analyzed.
The analyzed ompA gene sequences include about 898 to 940 bp fragment
extending from 161 bp downstream from starting codon of ompA gene to 1,098 bp
position. It includes all four hyper variable domains (VDs). The combined constant
domains (CDs) of 631 bp and variable domains of 267 to 309 bp were analyzed separately.
Calculation of percent identity matrix and multiple alignments of the trimmed sequences
was done using ClustalX, version 1.83 (198). Phylogenetic analysis was done with
programs in the PHYLIP (version 3.6a3; [http://evolution.genetics.washington.edu/phylip.
![Page 47: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/47.jpg)
42
html]). The distance matrix between species was computed by DNADIST using Jukes-
Cantor model (93) and clustering of lineages was done by NEIGHBOR using neighbor-
joining method (170). The bootstrap values were calculated to evaluate the branching
reliability of trees from a consensus tree constructed by generating 1,000 random data sets
using SEQBOOT (45).
in-silico AluI random fragment length polymorphism (RFLP) map: The
comparative AluI RFLP maps of different C. psittaci strains were generated by using
Genetyx-Mac, version 13.0.6 (SDC, Tokyo, Japan).
RESULTS
We initially analyzed relative evolution of whole ompA gene among all species of
family Chlamydiaceae vis-à-vis species of new C. psittaci group. Then comparative
analysis of constant/conserved domains (CDs) and variable domains (VDs) of all
genetically variable C. psittaci strain was done for genetic clustering and comparison.
Evolution of ompA gene among the members of Chlamydiaceae family: The
neighbor-joining (NJ) tree in Fig. 6 is showing phylogenetic distances among the
Chlamydophila spp. and Chlamydia spp. infecting human and various types of animal and
avian species. Clear separation of Chlamydophila spp. and Chlamydia spp. into two clans
irrespective of human and animal chlamydiae was observed. Furthermore on the basis of
ompA gene, host specific clustering of Chlamydia spp. or Chlamydophila spp. strains was
observed with exception of C. psittaci strains of avian origin. The C. psittaci strains form
distinct small clusters diverging out from other clusters of Chlamydophila spp.
ompA-gene based genetic clustering of C. psittaci: Various clusters and
subclusters of C. psittaci strains are resolved in the NJ tree of about 940 bp segment of
![Page 48: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/48.jpg)
CPX0308
C. muridarum-MoPn (U60196)C. muridarum-Nigg (AE002160)
C. muridarum-NiggII (X63409)
C. muridarum-SFPD (L19221)
C. trachomatis-D/IC-Cal-8 (X62920)
C. trachomatis-L1(M36533)
C. trachomatis-alfa/95 (U80075)C. trachomatis-LGV (L35605)
C. trachomatis-L-2 (L2/434/Bu) (M14738)
C. trachomatis-E/Bour (DQ064286)
C. trachomatis- IC-Cal3 (X52080)
C. trachomatis-J/UW36/Cx (AF063202)
C. trachomatis- K/UW31/Cx (AF063204)
C. trachomatis- C/TW3/OT (AF352789)
C. suis- PCLH197 (AJ440241)
C. psittaci-BorgC. psittaci-TT3
C. psittaci-Daruma
C. psittaci-Avian Type CC. psittaci-CT1C. psittaci-GDC. psittaci-M56
C. psittaci-MAT116
C. psittaci-30AC. psittaci-A22/M
C. psittaci-N352
C. psittaci-KKCP2C. psittaci-KKCP1
C. psittaci-CP3
C. psittaci-6BC
C. psittaci-MNZhangC. psittaci-N1
C. psittaci-Izawa
C. psittaci-GV
C. psittaci-NoséC. psittaci-Itoh
C. psittaci-CP0315
0.05 units
C. felis-FP Cello (AF269258)C. felis-FP Baker (AF269257)C. felis-FEPN (M73037)
C. felis-FPn/pring (X61096)C. felis-Fe/C56 (AP006861)
C. caviae-GPIC (AE015925)C. caviae-Zhang GPIC
C. caviae-GPIC (AF269282)
C. pecorum-LW613 (AJ440240)
C. pneumoniae-CSF (AF131889)C. pneumoniae-IOL-207 (M64064)C. pneumoniae-AR39 (AE002161)
C. pneumoniae-N16 (L04982)
C. abortus-LLG (AF272945)
C. abortus-B577 (M73036)C. abortus-BA1 (L39020)C. abortus-EBA (AF269256)
C. abortus-S26/3 (X51859)C. abortus-TWC+3/95-H (DQ471955)C. abortus-Taiwan strain (DQ227703)C. abortus-Taiwan strain (DQ478954)C. abortus-OCLH196 (AJ004873)
Genus- Chlamydia
Genus- Chlamydophila
HUMAN
MURINE
GUINEA PIG
RUMINANT
HUMAN
FELINE
SWINE
GUINEA PIG
RUMINANT
EQUINE
AVIAN
AVIAN
AVIAN
Fig. 6. Neighbor joining (NJ) tree of ompA gene ORF showing host species specific clustering of Chlamydophila spp. and Chlamydia spp. infecting human and various animal species. The tree rev--ealed diverse clusters of Chlamydophila spp. of avian origin. The bootstrap values are shown nearto respective nodes. The genetic distance is shown in units scale bar. The accession numbers of C.psittaci strains are shown in Table 7.
100%
100%100%
100% 100%
100%
100%
100%
100% 100%
100%
99.6%
![Page 49: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/49.jpg)
CPX0308
C. caviae-OK135
C. psittaci-WC
C. psittaci -7778B15C. psittaci -VS225
C. psittaci -84/2334C. psittaci -Daruma
C. psittaci -R54C. psittaci -Avian Type CC. psittaci -CT1C. psittaci -GD
C. psittaci -TT3C. psittaci -92-1293C. psittaci -7344/2C. psittaci -NJ1C. psittaci -Borg*
C. psittaci -M56C. psittaci -Mat116
C. psittaci -A22/MC. psittaci -3759/2C. psittaci -MN*C. psittaci -MNOsC. psittaci -MNRhC. psittaci -30A*C. psittaci -N352C. psittaci -98AV2129C. psittaci -WS/RT/E30C. psittaci -CP3
C. psittaci -41A12C. psittaci -KKCP2*C. psittaci -KKCP1*
C. psittaci -6BCC. psittaci -Fulmar#10C. psittaci -MN Zhang*
C. psittaci -84-55C. psittaci -N1*C. psittaci -Nosé*C. psittaci -Itoh*C. psittaci -GVC. psittaci -CP0315*C. psittaci -Izawa-1*C. psittaci -90/1051
0.02 units
C. abortus-B577 (M73036)C. abortus-BA1 (L39020)C. abortus-EBA (AF269256)C. abortus-S26/3 (X51859)
C. abortus-pm112 (AJ005613)C. abortus-pm225 (AJ005617)
C. abortus-pm234 (AJ004874)C. abortus-pm326 (AJ004875)
C. abortus-pmSH1 (AJ005618)C. abortus-pmd623 (AJ005615)
C. abortus-LW508 (M73040)
C. abortus-TWC+3/95-H (DQ471955)C. abortus-Taiwan strain (DQ227703)
C. abortus-Taiwan strain (DQ478954)
C. abortus-OCLH196 (AJ004873)C. abortus-LLG (AF272945)
C. caviae-GPIC (AE015925)
C. caviae-Zhang GPICC. caviae-GPIC (AF269282)
C. felis-FP Cello (AF269258)C. felis-FP Baker (AF269257)C. felis-FEPN (M73037)C. felis-FPn/pring (X61096)
C. felis-Fe/C56 (AP006861)
C. pecorum-L71 (AF269280)C. pecorum-LW613 (AJ440240)
C. pecorum-1710S (AF269279)
C. pneumoniae-CSF (AF131889)C. pneumoniae-IOL-207 (M64064)C. pneumoniae-AR39 (AE002161)
C. pneumoniae-N16 (L04982)
A
B
E
B/E
?
??
D
F
C
??
?
?
Fig. 7. The partial ompA gene (including VDs) based NJ tree showing the relative evolutionarydistance among different genetic clusters of C. psittaci strains. The known genotypes from A to F and E/B are demarcated by the dotted lines. The unknown/unclassified genotypes are questi--on marked (?). Asterisk mark (*) indicates the C. psittaci strains with human psittacosis history.The bootstrap values are shown againt each node. The genetic distance is shown in units scale bar.
100%
100%
100%
99.2%
86.8%
97.3%
96.7%
95.9%
100%
100%
100%
100%
100%79.4%
100%
100%
100%
100%
100%
![Page 50: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/50.jpg)
45
ompA gene that includes all 4 variable domains (Fig. 7). The distribution analysis of the
genetic distances and percent dissimilarities in C. psittaci strains (conserved regions only)
showed 4 groups of peaks. The ranges of genetic distance values for these 4 groups are
0.002 to 0.04, 0.061to 0.122, 0.133 to 0.156 and 0.194 to 0.211 (Fig. 8).
Fig. 8. Distribution of the genetic distances in the conserved regions of ompA gene of C. psittaci
strains. Genetic distances were calculated by Jukes-Cantor method (93).
Then by tabulating the genetic distance and dissimilarity matrices and plotting NJ
distance trees did the detailed analysis of clustering patterns of C. psittaci strains.
(i) Constant domains. All 21 C. psittaci strains with variant CDs were included in
analysis along with other representative Chlamydophila spp. Previously unclassified
Mat116, R54, Daruma, 84/2334 and CPX0308 strains were observed to be
phylogenetically diverse. On the basis of genetic distance and dissimilarity matrices and
![Page 51: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/51.jpg)
46
the NJ tree of CDs, all the C. psittaci strains were divided into 4 broad lineages and 8
genetic clusters named from I to VIII (Fig. 9-A, Tables 9 and 10). The genetic distance
among strains within a lineage is less than 0.1 (dissimilarity less than 10%). Whereas,
within these lineages strains having genetic distance less than 0.05 (dissimilarity less than
5%) are divided into genetic clusters. Lineage-1 has only one large cluster of genetically
similar strains mainly detected from psittacine bird, pigeons and ratites. The lineage-2 has
5 genetic clusters of genetically diverse strains mostly detected from poultry, water birds,
psittacine and other non-psittacine birds. The lineage-3 is represented by WC strain, a
bovine enteritis isolate, and lineage-4 by CPX0308 strain, detected from an oriental white
stork. The genetic distance among all C. psittaci strains is less than 0.156 except CPX0308
strain that has genetic resemblance to mammalian Chlamydophila spp. than avian type.
The nearest avian strain is V225 with genetic distance of 0.188. The relative difference in
nucleotide and amino acid numbers among 4 lineages and 8 genetic clusters are shown in
Table 10. It showed that seemingly large number of nucleotide variations do not reflect the
resultant amino acid variation within respective lineages or genetic clusters.
(ii) Variable domains. Total 18 C. psittaci strains having variation in VDs regions
were analyzed. KKCP1, KKCP2, Mat156, R54, Daruma, 84/2334 and CPX0308 strains
were observed to be phylogenetically distinct (Fig. 9-B). All the 8 genetic clusters from I
to VIII were also distinguishable but lower degree of percent identity and higher genetic
distance was found within each genetic cluster and designated lineages (Fig. 9-B and Table
11). The percent identity between 4 lineages was found to be less than 67%. Each genetic
cluster contains the same type of strains as that in CDs based tree.
Phylogenetic positions of CPX0308 and Daruma strain: Two highly genetically
diverse strains of avian origin CPX0308 and Daruma were compared with other members
of family Chlamydiaceae. The NJ tree of 16S rRNA gene is shown in Fig. 10. CPX0308
![Page 52: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/52.jpg)
47
Fig. 9. NJ trees based on the constant domain regions (A) and the variable domains (B), of
ompA gene showing genetic clusters of C. psittaci strains and other Chlamydophila spp.
The genetic clusters of C. psittaci strains from I to VIII are demarcated by the vertical solid
lines and known genotypes from A to F and E/B by dotted lines. The unknown/unclassified
genotypes are question marked (?). The C. psittaci strains with the history of human
psittacosis are marked by asterisk (*). The genetic distance is shown in units scale bar.
![Page 53: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/53.jpg)
(A) (B)
Izawa-1*CP0315*
84-5590/1051Itoh
N1NoséMN Zhang*
6BCFulmar#10
41A12CP3
N352WS/RT/E30
MNRh
MNOsMN
KKCP1KKCP2
A22/M3759/2
98AV2129
30AMat116
M56WC
92-12937344/2BorgNJ1TT3
7778B15VS225
Avian type CCT1GD
R5484/2334
Daruma
CPX0308
0.05 units
C. abortus-B577 (M73036)C. abortus-BA1 (L39020)C. abortus-EBA (AF269256)C. abortus-S26/3 (X51859)
C. abortus-pm112 (AJ005613)C. abortus-pm225 (AJ005617)
C. abortus-pm234 (AJ004874)C. abortus-pm326 (AJ004875)
C. abortus-pmSH1 (AJ005618)C. abortus-pmd623 (AJ005615)
C. abortus-LW508 (M73040)C. abortus-TWC+3/95-H (DQ471955)
C. abortus-Taiwan strain (DQ227703)C. abortus-Taiwan strain (DQ478954)
C. abortus-OCLH196 (AJ004873)C. abortus-LLG (AF272945)
C. caviae-GPIC (AE015925)
C. caviae-GPIC (AF269282)
C. felis-FP Cello (AF269258)
C. felis-P Baker (AF269257)C. felis-FEPN (M73037)
C. felis-FPn/pring (X61096)C. felis-Fe/C56 (AP006861)
C. pecorum-L71 (AF269280)C. pecorum-LW613 (AJ440240)
C. pecorum-1710S (AF269279)C. pneumoniae-CSF (AF131889)C. pneumoniae-IOL-207 (M64064)C. pneumoniae-AR39 (AE002161)
C. pneumoniae-N16 (L04982)
C. caviae-GPIC-Zhang
GV
I
VII
II
III
VI
V
IV
VIII
A
B
E
B/E
??
?
D
F
C
?
?
?
**
*
*
*
*
**
6BC
84-55
MN Zhang*Izawa-1*
GVFulmar#10
CP0315*90/1051
Itoh*
Nosé*
05/02*
41A12
KKCP1*KKCP2*
CP3
98AV2129N352WS/RT/E30
30A*3759/2A22/MMNOs
MNRhMN*
Mat116M56
WC
92-12937344/2Borg*NJ1TT3
Avian Type CCT1GD
R547778B15VS225
84/2334Daruma
CPX0308
C. caviae-GPIC
0.05 units
C. abortus-B577 (M73036)C. abortus-BA1 (L39020)C. abortus-EBA (AF269256)
C. abortus-S26/3 (X51859)C. abortus-pm112 (AJ005613)
C. abortus-pm225 (AJ005617)C. abortus-pm234 (AJ004874)C. abortus-pm326 (AJ004875)C. abortus-pmSH1 (AJ005618)
C. abortus-pmd623 (AJ005615)
C. abortus-LW508 (M73040)
C. abortus-TWC+3/95-H (DQ471955)
C. abortus-Taiwan strain (DQ227703)C. abortus-Taiwan strain (DQ478954)
C. abortus-OCLH196 (AJ004873)
C. abortus-LLG (AF272945)
C. caviae-GPIC (AE015925)
C. caviae-GPIC (AF269282)
C. felis-FP Cello (AF269258)
C. felis-FP Baker (AF269257)C. felis-FEPN (M73037)
C. felis-FPn/pring (X61096)
C. felis-C56 (AP006861)
C. pecorum-L71 (AF269280)C. pecorum-LW613 (AJ440240)C. pecorum-1710S (AF269279)
C. pneumoniae-CSF (AF131889)C. pneumoniae-IOL-207 (M64064)
C. pneumoniae-AR39 (AE002161)
C. pneumoniae-N16 (L04982)
N1*
I
VII
II
III
VI
V
IV
VIII
A
B
E
B/E
?
??
D
F
C
?
?
?
?
100%
100%
100%
100%
100%
93.7%
84.6%
97.9%
100%
91.2%
100%
100%
100%
100%
100%
100%
99.6%
99.4%
100%
100%
100%
99.2%
100%
100%
94.9%
92.4%
82%
100%
100%
100%
92.9%
![Page 54: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/54.jpg)
Table 9. Grouping of genetically diverse C. psittaci strains based on the genetic distance in constant domains of the ompA gene, calculated by Jukes-Cantor method (93). The C. psittaci strains having genetic
distance less than 0.1 are grouped in a lineage and those less than 0.05 genetic distance are grouped togather into a single cluster. Only the representative genetically variant strains of C. psittaci were taken for
analysis. The other Chlamydophila species are shown with grey background. Different genetic clusters are demarcated by solid lines and lineages by dotted lines.
Lin.-3 Lin.-4
Chlamydial species Accession 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27
no.
1-C. psittaci-GV L25437 0.000
2-C. psittaci-Nosé AB284060 0.002 0.000
3-C. psittaci-Izawa-1 AB284057 0.003 0.002 0.000
4-C. psittaci-6BC M73035 0.003 0.002 0.003 0.000
5-C. psittaci-MN Zhang AF269281 0.005 0.003 0.005 0.005 0.000
6-C. psittaci-41A12 AY762609 0.006 0.005 0.006 0.003 0.008 0.000
7-C. psittaci-MN AF269262 0.006 0.005 0.006 0.003 0.008 0.003 0.000
8-C. psittaci-KKCP1 AB284062 0.006 0.005 0.006 0.003 0.008 0.003 0.000 0.000
9-C. psittaci-CP3 AF269265 0.010 0.008 0.010 0.006 0.011 0.003 0.006 0.006 0.000
10-C. psittaci-8455 CPS16561 0.013 0.011 0.013 0.013 0.014 0.016 0.016 0.016 0.019 0.000
11-C. psittaci-Mat116 AB284058 0.019 0.018 0.019 0.016 0.021 0.019 0.019 0.019 0.023 0.029 0.000
12-C. psittaci-M56 AF269268 0.034 0.032 0.034 0.031 0.036 0.034 0.034 0.034 0.031 0.044 0.031 0.000
13-C. psittaci-Borg AB284066 0.116 0.114 0.116 0.113 0.114 0.116 0.116 0.116 0.120 0.124 0.129 0.118 0.000
14-C. psittaci-92-1293 Y16562 0.118 0.116 0.118 0.114 0.116 0.118 0.118 0.118 0.122 0.126 0.131 0.120 0.002 0.000
15-C. psittaci-7778B15 AY762612 0.137 0.135 0.137 0.133 0.135 0.137 0.137 0.137 0.141 0.145 0.141 0.150 0.071 0.073 0.000
16-C. psittaci-VS225 AF269261 0.139 0.137 0.139 0.135 0.137 0.139 0.139 0.139 0.139 0.147 0.143 0.148 0.073 0.075 0.002 0.000
17-C. psittaci-Daruma AB284065 0.139 0.137 0.139 0.135 0.137 0.139 0.139 0.139 0.143 0.147 0.139 0.143 0.082 0.084 0.080 0.082 0.000
18-C. psittaci-84/2334 AJ310735 0.141 0.139 0.141 0.137 0.139 0.141 0.141 0.141 0.145 0.148 0.141 0.145 0.084 0.086 0.082 0.084 0.002 0.000
19-C. psittaci-R54 AJ243525 0.145 0.143 0.145 0.141 0.143 0.145 0.145 0.145 0.148 0.152 0.141 0.145 0.077 0.078 0.063 0.065 0.051 0.053 0.000
20-C. psittaci-GD AF269261 0.150 0.148 0.150 0.147 0.148 0.150 0.150 0.150 0.154 0.158 0.147 0.145 0.073 0.075 0.061 0.063 0.070 0.071 0.058 0.000
21-C. psittaci-WC AF269269 0.148 0.147 0.148 0.145 0.145 0.148 0.148 0.148 0.152 0.156 0.154 0.152 0.105 0.107 0.113 0.114 0.114 0.116 0.128 0.120 0.000
22-C. psittaci-CPX0308 AB284064 0.211 0.209 0.211 0.207 0.211 0.205 0.207 0.207 0.205 0.209 0.196 0.205 0.196 0.198 0.190 0.188 0.207 0.207 0.205 0.194 0.192 0.000
23-C. abortus-S26/3 X51859 0.152 0.150 0.152 0.148 0.150 0.152 0.152 0.152 0.156 0.160 0.148 0.148 0.091 0.093 0.071 0.073 0.087 0.089 0.065 0.080 0.128 0.203 0.000
24-C. caviae-GPIC AE015925 0.176 0.174 0.176 0.172 0.174 0.176 0.176 0.176 0.180 0.184 0.166 0.170 0.164 0.166 0.170 0.172 0.182 0.184 0.174 0.172 0.166 0.174 0.174 0.000
25-C. felis-C56 AP006861 0.188 0.186 0.188 0.184 0.182 0.188 0.188 0.188 0.192 0.200 0.180 0.180 0.160 0.162 0.160 0.162 0.172 0.174 0.154 0.166 0.174 0.186 0.168 0.170 0.000
26-C. pneumoniae-AR39 AE002161 0.284 0.282 0.284 0.280 0.282 0.280 0.280 0.280 0.280 0.296 0.273 0.289 0.280 0.282 0.284 0.282 0.293 0.293 0.296 0.289 0.282 0.312 0.305 0.301 0.277 0.000
27-C. pecorum-L71 AF269280 0.313 0.311 0.313 0.308 0.313 0.308 0.308 0.308 0.313 0.313 0.316 0.316 0.289 0.292 0.304 0.306 0.316 0.318 0.311 0.311 0.308 0.320 0.320 0.304 0.333 0.269 0.000
Designated
genetic clusters VIII Other Chlamydophila spp.III IV V VIII II
Lineage-1 Lineage-2
VI
![Page 55: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/55.jpg)
Table 10. The difference in number of nucleotides (upper right triangular half) and amino acids (lower triangular half) among different lineages and genetic clusters of C. psittaci strains in constant domains of
the ompA gene. Only the representative genetically variant strains of C. psittaci were taken for analysis. Other Chlamydophila species are demarkated by grey background. Different genetic clusters are
demarcated by solid lines and lineages by dotted lines.
Lin.-3 Lin.-4
Chlamydial species Accession 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27
no.
1- C. psittaci- GV L25437 0 1 2 2 3 4 4 4 6 8 12 21 68 69 79 80 80 81 83 86 85 116 87 99 105 150 163
2- C. psittaci- Nosé AB284060 1 0 1 1 2 3 3 3 5 7 11 20 67 68 78 79 79 80 82 85 84 115 86 98 104 149 162
3- C. psittaci- Izawa-1 AB284057 2 1 0 2 3 4 4 4 6 8 12 21 68 69 79 80 80 81 83 86 85 116 87 99 105 150 163
4- C. psittaci- 6BC M73035 2 1 2 0 3 2 2 2 4 8 10 19 66 67 77 78 78 79 81 84 83 114 85 97 103 148 161
5- C. psittaci- MN Zhang AF269281 1 0 1 1 0 5 5 5 7 9 13 22 67 68 78 79 79 80 82 85 83 116 86 98 102 148 163
6- C. psittaci- 41A12 AY762609 4 3 4 2 3 0 2 2 2 10 12 21 68 69 79 80 80 81 83 86 85 113 87 99 105 148 161
7- C. psittaci- MN AF269262 4 3 4 2 3 1 0 0 4 10 12 21 68 69 79 80 80 81 83 86 85 114 87 99 105 148 161
8- C. psittaci- KKCP1 AB284062 4 3 4 2 3 1 0 0 4 10 12 21 68 69 79 80 80 81 83 86 85 114 87 99 105 148 161
9- C. psittaci- CP3 AF269265 5 4 5 3 4 1 2 2 0 12 14 19 70 71 81 80 82 83 85 88 87 113 89 101 107 147 169
10- C. psittaci- 84-55 CPS16561 4 3 4 4 3 6 6 6 7 0 27 18 72 73 83 84 84 85 87 90 89 115 91 103 111 155 163
11- C. psittaci- Mat116 AB284058 4 3 4 2 3 4 4 4 5 6 0 19 75 76 81 82 80 81 81 84 88 109 85 94 101 145 164
12- C. psittaci- M56 AF269268 4 3 4 2 3 4 4 4 3 6 4 0 69 70 86 85 82 83 83 83 87 113 85 96 101 152 164
13- C. psittaci- Borg AB284066 10 9 10 8 9 10 10 10 11 12 10 10 0 1 43 44 49 50 46 44 62 109 54 93 91 148 153
14- C. psittaci- 92-1293 Y16562 11 10 11 9 10 11 11 11 12 13 11 11 1 0 44 45 50 51 47 45 63 110 55 94 92 149 154
15- C. psittaci- 7778B15 AY762612 13 12 13 11 12 13 13 13 14 15 11 13 7 8 0 1 48 49 38 37 66 106 43 96 91 150 159
16- C. psittaci- VS225 AF269261 13 12 13 11 12 13 13 13 14 15 11 13 7 8 0 0 49 50 39 38 67 105 44 97 92 149 160
17- C. psittaci- Daruma AB284065 9 8 9 7 8 9 9 9 10 11 9 9 3 4 4 4 0 1 31 42 67 114 52 102 97 154 162
18- C. psittaci- 84/2334 AJ310735 10 9 10 8 9 10 10 10 11 12 10 10 4 5 5 5 1 0 32 43 68 114 53 103 98 154 163
19- C. psittaci- R54 AJ243525 10 9 10 8 9 10 10 10 11 12 9 10 4 5 4 4 1 2 0 35 74 107 74 94 98 145 161
20- C. psittaci- GD AF269261 11 10 11 9 10 11 11 11 12 13 9 11 6 7 6 6 4 5 4 0 70 113 39 98 88 155 160
21- C. psittaci- WC AF269269 12 11 12 10 11 11 11 11 12 14 12 12 7 8 10 10 8 9 9 20 0 108 48 97 94 152 162
22- C. psittaci- CPX0308 AB284064 31 30 31 29 30 28 28 28 29 33 29 31 27 28 26 26 28 28 28 29 27 0 112 98 104 161 165
23- C. abortus-S26/3 X51859 12 11 12 10 11 12 12 12 13 14 11 12 8 9 5 5 5 6 4 8 9 27 0 98 95 159 166
24- C. caviae- GPIC AE015925 20 19 20 18 19 20 20 20 21 22 16 20 19 20 15 15 18 19 18 20 19 28 18 0 96 158 157
25- C. felis-C56 AP006861 21 20 21 19 20 21 21 21 22 23 19 21 16 17 18 18 16 17 17 19 18 27 18 22 0 146 163
26- C. pneumoniae-AR39 AE002161 45 44 45 44 44 44 44 44 45 47 42 46 43 44 41 41 41 41 41 42 42 42 42 42 39 0 145
27- C. pecorum-L71 AF269280 44 43 44 43 43 43 43 43 44 46 44 45 43 44 44 44 41 42 41 43 43 46 43 47 45 38 0
Other Chlamydophila spp.II III IV V VI VII VIII
Lineage-1 Lineage-2
IDesignated genetic clusters
![Page 56: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/56.jpg)
Table 11. Percentage identity matrix (PIM) of nucleotides in the genetically variable regions (VDs) of ompA gene of different lineages and genetic clusters of C. psttaci strains. The
PIM was calculated by ClustalX, version 1.83. The other Chlamydophila species are marked by grey background. The lineages are marked by dotted lines, whereas, the genetic
clusters are marked by solid lines.
Lin.-3 Lin.-4
Chlamydial species Accession No. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23
1-C. psittaci-05/02 DQ324426 100
2-C. psittaci- Nosé AB284060 100 100
3-C. psittaci- 84-55 CPS16561 99 100 100
4-C. psittaci- 6BC M73035 99 100 99 100
5-C. psittaci- CP3 AF269265 98 98 98 98 100
6-C. psittaci- KKCP1 AB284062 97 98 97 98 100 100
7-C. psittaci- MN AF269262 97 97 97 98 99 98 100
8-C. psittaci- WS/RT/E30 AY762613 97 97 97 98 99 98 99 100
9-C. psittaci- Mat116 AB284058 95 95 95 95 95 94 94 94 100
10-C. psittaci- M56 AF269268 89 89 88 89 87 87 87 87 89 100
11-C. psittaci- Borg AB284066 66 66 67 66 66 66 66 66 66 67 100
12-C. psittaci- VS225 AF269261 60 61 61 61 61 61 60 61 60 60 72 100
13-C. psittaci- R54 AJ243525 60 59 60 59 59 59 59 59 59 60 71 84 100
14-C. psittaci- 84/2334 AJ310735 56 56 56 56 56 56 56 56 56 56 67 83 81 100
15-C. psittaci- Daruma AB284065 56 56 57 56 57 56 57 56 57 57 68 85 81 98 100
16-C. psittaci- GD AF269261 55 55 55 55 55 55 55 55 54 56 70 76 79 77 78 100
17-C. psittaci- WC AF269269 62 61 62 61 61 61 61 61 60 61 70 65 66 65 65 63 100
18-C. psittaci- CPX0308 AB284064 59 58 59 58 58 58 58 58 58 60 67 67 62 60 61 63 62 100
19-C. abortus-S26/3 X51859 59 59 60 59 59 59 58 59 58 60 68 89 82 82 85 73 64 65 100
20-C. felis-C56 AP006861 59 59 59 59 59 60 59 59 59 59 68 69 72 63 65 64 62 62 69 100
21-C. pneumoniae-AR39 AE002161 55 55 55 55 56 55 56 56 56 56 60 61 58 56 58 59 54 62 61 59 100
22-C. caviae- GPIC AE015925 54 54 54 54 54 55 55 55 55 53 62 69 70 65 67 64 61 59 67 67 58 100
23-C. pecorum-L71 AF269280 52 52 52 52 52 52 52 52 52 52 57 57 57 57 57 53 55 60 56 58 53 61 100
VII VIII Other Chlamydophila spp.
Lineage-2
III IV V VIDesignated genetic clusters I
Lineage-1
II
![Page 57: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/57.jpg)
C. psittaci-Koala (AB001789)C. psittaci-Sugimoto-F (AB001812)C. psittaci-Mizuno-1F (AB001790)C. psittaci-Izawa-1 (AB001788)C. psittaci-Itoh (AB001787)C. psittaci-GCP-1 (AB001786)C. psittaci-Bud-5695 (AB001782)C. psittaci-6BC (CPU68447)
C. psittaci-Ohmiya (AB001791)C. psittaci-Sugawara (AB001813)C. psittaci-Bud-1 (AB001779)
C. psittaci-Bud-11F (AB001780)C. psittaci-Bud-16F (AB001781)
C. psittaci-P1307 (AB001795)C. psittaci-P1321 (AB001798)
C. psittaci-P1313 (AB001796)C. psittaci-P1315 (AB001797)C. psittaci-P1605 (AB001799)C. psittaci-T4 (AB001815)C. psittaci-PCM27 (AB001804)C. psittaci-PCM30 (AB001805)
C. psittaci-Cal-10 (AB001784)C. psittaci-P1015 (AB001792)C. psittaci-P1041 (AB001793)C. psittaci-P1305 (AB001794)C. psittaci-P1646 (AB001800)C. psittaci-P1888 (AB001801)C. psittaci-PCM131 (AB001803)C. psittaci-Tk-Cal (AB001816)
C. psittaci-PCM9 (AB001808)C. psittaci-PCM44 (AB001806)C. psittaci-PCM55 (AB001807)
C. psittaci-Frt-Hu/Ca110 (D85712)C. psittaci-PgAu46 (AB001802)C. psittaci-T3 (AB001814)
C. psittaci-Tk-NJ (CPU68419)C. psittaci-Hu/Borg (D85711)
C. psittaci-Prk46 (AB001809)C. psittaci-Prk48 (AB001810)C. psittaci-Daruma (AF481048)C. abortus-Ov/B577 (D85709)
C. abortus-EBA (U76710)C. abortus-S26/3 (CR848038)
C. psittaci-Prk49 (AB001811)C. caviae-GPIC (AE015925)
C. caviae-OK135C. caviae- GPIC (D85708)
CPX0308 (AB285329)C. felis-Fe/145 (D85702)
C. felis-Fe/C56 (AP006861)C. felis-Fe/429 (D85707)
C. felis-Cello (D85706)C. felis-Fe/Pn-1(D85701)
C. felis- Fe/164 (D85704)C. pecorum-Bo-1485 (AB001774)
C. pecorum-Bo-Yokohama (AB001776)C. pecorum-Bo/Shizuoka (D85714)
C. pecorum-Koala type II (D85717)C. pneumoniae-CWL029 (AE001668)
C. pneumoniae-TW183 (AE017160)
0.005 units
Fig. 10. The 16S rRNA gene based neighbor-joining (NJ) tree showing the evolutionary distanceof the CPX0308 and Daruma strains of C. psittaci (bold letter) in comparison to the other known species of genus Chlamydophila. The accession numbers are shown in parentheses. The geneticdistance is shown in units scale bar. The bootstrap values are shown againt nodes.
73.4%
77.3%
84.8%
79.4%
94.8%
98.7%80.6%
100%
99.8%
100%
100%
![Page 58: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/58.jpg)
53
strain showed genetic distance of 0.006 from the closest relative, Daruma strain, while
Daruma strain was genetically closest, that is 0.001 to C. abortus S26/3 strain, (Table 12-
A). According to the CDs of the ompA gene, CPX0308 strain was the closest to C. caviae
GPIC strain with genetic distance of 0.176, while Daruma strain showed genetic distance
of 0.051 from R54 strains of C. psittaci. However, on the basis of partial ompA gene
(including VDs), the closest relatives of CPX0308 and Daruma were V225 and R54 strains
of C. psittaci with distance of 0.255 and 0.096, respectively (Table 12-B and C).
Therefore, Daruma strain was phylogenetically intermediate between the clusters formed
by C. psittaci and C. abortus species, whereas, CPX0308 strain appeared to be
intermediate between cluster of C. psittaci and C. abortus species and that of C. caviae and
C. felis species. Therefore, CPX0308 and Daruma strains are grouped into the lineage-4
(cluster VIII) and lineage-2 (clusters IV), respectively.
Human psittacosis strains: The majority of C. psittaci strains isolated from human
psittacosis patients or from in-contact avian species was observed to be belonging to
lineage-1 and genetic cluster I. These strains are predominantly prevalent among psittacine
and pigeons, though also reported from other avian and mammalian species. The recently
reported OSV and 05/02 strains (Table 7) from human psittacosis outbreak were also
similar to strains of genetic cluster I. OSV strain is 99.78%, 99.02% and 99.78% similar to
6BC, CP3 and MN strains, respectively, whereas, 05/02 strain was 99.80%, 99.09% and
98.88% similar to 6BC, CP3 and MN strains, respectively. Interestingly, KKCP1 and
KKCP2 strains showed characteristics of both MN (formerly grouped as genotype/serotype
E) and CP3 (formerly grouped as genotype/serotype B) and form intermediate subcluster
between them (Fig. 9 B). Second type of C. psittaci strains involved in human psittacosis
belongs to genetic cluster II that has been known as serotype/genotype D strain. These
strains are mostly reported from poultry birds.
![Page 59: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/59.jpg)
Table 12. Genetic distance of CPX0308 and Daruma strains vis-à-vis other Chlamydophila spp. and Chlamydia spp. based on A) 16S rRNA gene, B) constant domains of partial ompA gene, C) partial ompA gene including variable
domains. The distance was calculated by Jukes-Cantor method (93) using Phylip. The two nearest species/strains are shown in grey background.
A)C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. abortus C. caviae C. felis C. pecorum C. pneumoniae C. trachomatis C. suis C. muridarum
CPX0308 Daruma 6BC Itoh PCM9 Cal10 P1307 P1015 T3 Borg Tk-NJ PCM27 T4 S26/3 GPIC Fe/C56 Bo-1485 CWL029 D/UW-3/CX S45 Nigg
CPX0308 0.000 0.006 0.007 0.007 0.010 0.009 0.010 0.009 0.010 0.009 0.009 0.010 0.010 0.007 0.009 0.017 0.039 0.046 0.049 0.059 0.045
Daruma 0.006 0.000 0.002 0.002 0.005 0.004 0.005 0.004 0.007 0.006 0.006 0.005 0.005 0.001 0.009 0.016 0.038 0.043 0.051 0.059 0.045
Accession no. AB285329 AF481048 CPU68447 AB001787 AB001808 AB001784 AB001795 AB001792 AB001814 D85711 CPU68419 AB001804 AB001815 CR848038 AE015925 AP006861 AB001774 AE001668 AE001347 U73110 AE002160
B)
C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. psittaci C. abortus C. caviae C. felis C. pecorum C. pneumoniae C. trachomatis C. suis C. muridarum
CPX0308 Daruma 6BC Nosé CP3 MN Mat116 M56 R54 Borg GD VS225 WC S26/3 GPIC Fe/C56 LW613 AR39 D/UW-3/CX PCLH197 Nigg
CPX0308 0.000 0.207 0.207 0.209 0.205 0.207 0.196 0.205 0.205 0.196 0.194 0.188 0.192 0.203 0.176 0.186 0.296 0.312 0.322 0.339 0.319
Daruma 0.207 0.000 0.135 0.137 0.143 0.139 0.139 0.143 0.051 0.082 0.070 0.082 0.114 0.087 0.184 0.172 0.311 0.293 0.331 0.317 0.351
C)
CPX0308 0.000 0.288 0.293 0.296 0.294 0.297 0.288 0.293 0.281 0.257 0.271 0.255 0.273 0.268 0.260 0.263 0.385 0.377 0.458 0.461 0.401
Daruma 0.288 0.000 0.239 0.239 0.242 0.239 0.234 0.241 0.096 0.160 0.121 0.108 0.198 0.111 0.252 0.252 0.409 0.373 0.448 0.449 0.424
Accession no. AB284064 AB284065 M73035 AB284060 AF269265 AF269262 AB284058 AF269268 AJ243525 AB284066 AF269261 AF269261 AF269269 X51859 AE015925 AP006861 AJ440240 AE002161 X62920 AJ440241 AE002160
![Page 60: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/60.jpg)
55
Comparison of genetic cluster and AluI RFLP based genotyping method: The
AluI based RFLP maps are shown in Fig. 11. Mat116, KKCP1 and KKCP2 strain have
similar RFLP pattern but are genetically diverse with one another (Fig. 7 and Fig. 9).
Similarly, some closely related strains having single nucleotide polymorphism (SNP) at a
few positions with or without amino acid change could not be resolved by AluI based
RFLP genotyping.
DISCUSSION
For differentiation of C. psittaci strains, currently serotyping and genotyping
methodologies are used which have their own advantages and disadvantages (4, 174, 207).
But due to the incessant reports of existence of C. psittaci strains with major or minor genetic
variation among avian species and human psittacosis cases (33, 60, 77, 191), an alternative
and more accommodative strain classification system is desired. Existing methods are also
reported to have some ambiguity in strain differentiation (191, 207).
Therefore, in this study, we introduce an alternative genetic cluster based strain
classification scheme by using genetic distances and percentage identities. We analyzed the
conserved regions of the ompA gene, which have genetic evolution trajectory similar to other
portion of chlamydial genome (24). The VDs regions with excessive homoplasy were
analyzed separately. All the genetically variable strains are grouped into 4 lineages, which are
further subdivided into 8 genetic clusters named from I to VIII. This scheme accommodates
all C. psittaci strains with major or minor genetic differences and groups them according to
the actual genetic variation.
The genetic cluster I include 13 types of genetically variant C. psittaci strains. It
accommodates all closely related subclusters like that formed by KKCP1 and KKCP2 strain
due to small variations in VD2 and VD4 regions. Similarly a recently known E/B genotype
having only 2-nucleotide variations in VD4 region (60) was clubbed together with other
![Page 61: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/61.jpg)
100 500 1000
CPX0308 (14)
1200
30A, MN, N352 (13)
1200
Nosé, MN Zhang (12)
1200
KKCP1, KKCP2 (11)
Borg, TT3, NJ1 (8)
1200
Mat116 (11)
1200
Daruma(10)
1200
Izawa-1 (12)
1200
6BC (12)
1200
(10)
GD (9)
CP3
CP0305, GV, Itoh
84/2334* (7)
VS225 (12)
(10)WC
Genotypes Genetic
clusters
A
A
A
B
New genotype
New genotype
Unclassified genotype
New genotype
New genotype
E
C
D
F
Strains Restriction
sites no.
Nucleotide positions on ompA gene ORF
100 200 300 400 500 600 700 800 900 1000 1100 1200
I
I
I
I
I
I
I
VI
II
III
IV
IV
VII
VIII
1200
M56 (9) I
(10) VR54*
Fig. 11. RFLP restriction map of the ompA gene based on AluI enzyme used to categorize various C. psittaci strains into A to F genotypes.
The unknown/unclassified genotypes and corresponding genetic clusters ( I to VIII) are also shown. The asterik (*) indicates that ORF of
R54 and 84/2334 strains are incomplete from 3’ and 5’ ends respectively. The variable domains (VDs) are demarcated by thick lines in the
top line diagram of ompA gene, which is showing the nucleotide positions in the ORF.
Unclassified genotype
Unclassified genotype
Unclassified genotype
VD1 VD2 VD3 VD4
![Page 62: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/62.jpg)
57
closely related subclusters. The R54 strain detected from brown skua (79) has been placed
in genetic cluster V in a group of highly diverse strains (lineage-2). Similarly, we grouped
Daruma strain along with 84/2334 strain in genetic cluster IV, which is intermediate in
evolution between C. abortus and C. psittaci groups (205). The 84/2334 strain was
previously classified as serotype A (207) based on Mab against MOMP, which include
genetically different group of strains. The CPX0308 strain has been grouped as genetic
cluster VIII in lineage-4. Hence, proposed scheme of strain classification correctly group
different genetically variant strains.
The PCR based chlamydial detection techniques have overcome the problem
associated with chlamydial isolations for diagnosing the infection. These procedures are
now increasingly used in large-scale epidemiological studies, strain differentiations and for
quick clinical diagnosis. The genetic distance based classification can also accommodates
uncultured chlamydiae. It also overcomes the constrains associated with serotyping
techniques that need isolation of C. psittaci strains before typing, which is not possible in
some cases due to zoonotic risk. Furthermore, it is known that immunodominat epitopes
recognized by monoclonal antibodies used in serotyping studies, reside in the hypervariable
regions of ompA gene. Therefore, the correspondence between ompA-RFLP and MOMP
serotyping is not absolute and the results in some strains can be misinterpreted (174, 191).
The AluI RFLP pattern based ambiguities among Mat116, KKCP1 and KKCP2 strains also
indicate that genotypic classification using only one restriction enzyme is not representative.
Therefore, the new strain classification scheme represents much more the actual genetic
diversity among C. psittaci strains.
The lineages of C. psittaci strains also reflect their evolutionary patterns. The
lineages-1 strains have adapted to avian species and appear mostly capable of infecting in-
contact animals and human beings. The strains of lineage-2 contains 5 genetic clusters of
strains that appeared to be recently adapted to avian species as was estimated by their low
![Page 63: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/63.jpg)
58
prevalence. The C. abortus group that has been recognized as distinct pathobiotype (40,
43, 199), has been evolving from hypothetic ancestor belonging to lineage-2. The
CPX0308 strain analyzed by ompA gene and additional 16S rRNA gene sequences seems
to be an intermediate between group of C. psittaci and C. abortus and other
Chlamydophila spp. of mammalian origins. This CPX0308 strain may have the common
ancestor for this cluster. Further genetic studies of such strains in details are needed to
establish their exact phylogenetic positions in relation to other chlamydial species.
The evolutionary basis of epidemiological success and pathobiology of C. psittaci
strains is difficult to examine due to non-availability of whole genome sequence data. In
our study, the analysis of C. psittaci strains isolated/detected from human psittacosis
patients or in-contact avian hosts revealed that C. psittaci strains belongs to genetic
clusters I are mostly responsible for human psittacosis. Recently, similar types of strains
were reported from an outbreak in Netherlands (77). As these types of strains are mostly
prevalent in psittacine birds, there are numbers of reports of sporadic human psittacosis
cases or large scale outbreaks from ancient time to very recent time, where the probable
source is mentioned as psittacine birds or pigeons, but the genotypes of these strains were
not studied (37, 107, 113, 116, 123, 197). These types of strains are also reported from the
cases of swine, 98AV2129 strain (211), ewes, A22/M strain (147), Moorish tortoise (209)
and dog (68). This reflects the pathogenic potential of this group of strains not only to
human but also to other in-contact mammalian and non-mammalian hosts. The Borg strain,
which is involved in human psittacosis, belongs to genetic cluster II. Similar genotypes
may be involved in human psittacosis cases among the poultry industry workers (8, 117,
127).
Therefore, in this investigation, we grouped the C. psittaci strains according to a
modified scheme, which is genetically accommodative and appropriately represents actual
![Page 64: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/64.jpg)
59
genetic diversity among C. psittaci strains. It may help in understanding the evolutionary
patterns of C. psittaci strains and identifying the C. psittaci pathobiotypes associated with
avian/animals or zoonotic infections.
SUMMARY
Different genetically diverse C. psittaci strains detected from various avian and
mammalian hosts including human beings were genetically analyzed to evaluate the
phylogenetic relationships, pathobiotic implications and to improve the strain
categorization. All of the 11 new C. psittaci strains together with the previously described
35 strains were genetically analyzed in ompA gene locus. Conserved and variable domains
of ompA gene were analyzed separately and 16S rRNA gene of two highly diverse strains
CPX0308 and Daruma was also studied. On the basis of the conserved region of ompA
gene, 4 lineages of C. psittaci strains with genetic distance of less than 0.1 (dissimilarity
less than 10%) were identified. The C. psittaci strains of 4 lineages, with genetic distance
of less than 0.05 (dissimilarity less than 5%) were subdivided into 8 genetic clusters. The
ompA gene loci of the C. psittaci strains of lineage-1 are relatively conserved and the
strains were frequently involved in infection of human (psittacosis) and other mammalian
species. Lineage-2 strains are genetically diverse and divided into 5 genetic clusters.
Lineage-3 and 4, represented by WC and CPX0308 strains, respectively, are genetically
more close to Chlamydophila spp. causing infection among mammalian hosts. This scheme
classifies diverse strains according to their genetic variations and phylogenetic distances,
which is more appropriate to accommodate and classify closely and distantly related C.
psittaci strains. It may be useful to differentiate even uncultured C. psittaci strains detected
in clinical diagnosis.
![Page 65: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/65.jpg)
60
Examination of virulence patterns of the Chlamydophila psittaci strains
predominantly associated with avian chlamydiosis and human psittacosis
using BALB/c mice
INTRODUCTION
The Chlamydophila psittaci causes “avian chlamydiosis” among diverse avian
species, which is characterized by systemic, acute or chronic disease or
subclinical/inapparent infection with intermittent shedding of infectious EBs. Different C.
psittaci strains vary in virulence, which gives rise to variable incubation periods, clinical
signs and recovery time. Typical signs of a clinically apparent infection with virulent C.
psittaci strains include “pneumo-enteritis” with respiratory signs, mucopurulent nasal
discharge, diarrhea, polyuria and dullness (fluffed feathers and lethargy). Yellow-greenish
diarrhea is a common clinical sign. Occasionally unilateral or bilateral
conjunctivitis/keratoconjunctivitis, lameness and central nervous system disturbances may
be observed. The precipitation of disease and intensity of clinical signs and mortality also
depend upon avian species, chlamydial strains, environmental conditions and concurrent or
secondary infections (7, 8, 32, 188, 210).
The human infection by C. psittaci is called “psittacosis”, which was first named as
“psittakos” a Greek word meaning parrot (129). In 1879, Ritter observed this disease
among human first time due to exposure to tropical pet birds and named it
“pneumotyphous” (72, 158). Later world pandemic occurred in 1929 and 1930 due to
shipment of exotic birds from Argentina to Europe and North America and the causative
agent was first demonstrated in smears from infected birds and human patients (14, 34, 49,
CHAPTER-III
![Page 66: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/66.jpg)
61
111). Since then various sporadic cases or large outbreaks have been reported in many
countries (155, 197, 224). According to the Office International des Epizooties (IOE) data
on zoonotic cases by avian chlamydiosis (http://www.oie.int/hs2/report.asp) from 2000 to
2004 period, 545, 391, 412, 524 and 410 cases were reported by 13, 13, 15, 12 and 13
member countries, respectively. But many more case may have gone undiagnosed owing
to confusing symptoms and difficult diagnosis.
Primarily the clinical signs of human psittacosis varies from mild flu like symptoms
to severe atypical pneumonia with non productive cough, fever, muscular and joint pain
and headache (115, 197, 213, 224) but the secondary complications like myocarditis (109),
hepatitis (172), encephalitis/meningitis and neurological disturbances (29, 36, 138, 168),
skin erythema (66, 180) or multiple organ failure (201) can increase fatalities. Some
suspected human-to-human transmission has also been reported (85). In old literature
psittacosis is referred to all human illness caused by all species, which have formerly been
grouped under Chlamydia psittaci group, but we considered reports those specifically
mentioned avian contact or otherwise doubtful histories.
For studying the pathogenesis of chlamydial diseases, animal experimentation models
are mostly used, as the genetic manipulation of chlamydiae is not possible at present time.
Studies on relative virulence of C. psittaci strains of avian origin are very few. In 1958,
Page first studied pathogenicity of C. psittaci strains from turkey, psittacine and pigeon in
mice (141) and in turkeys (142) and reported that some turkey strains are more pathogenic.
Subsequently, there have been many reports of experimental animal infection with
chlamydiae both in attempt to provide animal models of human disease and to establish
etiological relationships between infection and disease. However, the use of animal
infections primarily to differentiate between chlamydial strains is limited. The mouse
toxicity protection test first provided evidence of strain variations within C. trachomatis (2,
![Page 67: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/67.jpg)
62
15). Rodolakis and colleagues differentiated invasive and non-invasive strains of C.
abortus by means of mice footpad inoculation experiments and found that invasive strain
infect placenta of pregnant mice (159) and sheep (161). These invasive C. abortus strains
formed a distinct genetic cluster, whereas non-invasive strains formed different clusters on
the basis of restriction endonuclease analysis of DNA (162) and RFLP patterns of ompA
gene (38).
Variation in the infectivity of C. psittaci strains to different avian and mammalian
hosts was observed in an earlier study (143). Different genetically and serologically variant
strains of C. psittaci have been identified in the newly classified Chlamydophila psittaci
group (43). We also divide all genetically diverse strains into 4 lineages and 8 genetic
clusters in CHAPTER II on the basis of the composition of ompA gene encoding the
MOMP. Depending upon MOMP specific panels of Mab and AluI RFLP pattern of ompA
gene, 8 serotypes and 7 genotypes are known (4, 56, 60, 174, 206, 207). The comparative
virulence and pathogenesis of different C. psittaci strains (new group) responsible for
avian chlamydiosis and human psittacosis has not been investigated in detail yet. The C.
psittaci strain of serovar D (turkey strains) and serovar A (parakeet strain) were observed
to be more invasive in experimentally infected turkeys than was serovar B (pigeon strains)
(212).
The murine infection models provide an important set of tools to identify the host
and organism factors responsible for disease pathogenesis. Different inbred and knockout
mice strains are used to study disease mechanisms of human (16, 21, 133, 223) and animal
(22, 124, 159) chlamydial infections. Therefore, in this study we compared the virulence of
C. psittaci strains predominantly detected form avian species and human psittacosis and
belonging to different genetic groups using murine model. Four C. psittaci strains were
intranasally inoculated in BALB/c mice and appearance of clinical signs, mortalities
![Page 68: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/68.jpg)
63
(LD50) and clearance of infection was analyzed. Two genotypes found mostly associated
with human psittacosis were found to have low LD50 for BALB/c mice.
MATERIALS AND METHODS
Chlamydiae: The 4 C. psittaci strains tested were, Nosé strain, isolated from a
budgerigar (Melopsittacus undulatus) that was in-contact with a human psittacosis patient
and was kindly provided by Prof. A. Matsumoto; MN/cal10 strain (49), isolated from
human/ferret in a human psittacosis outbreak; Mat116 strain isolated from a chestnut
fronted macaw (Ara severa) in an avian chlamydiosis out break in Japan (This study);
Borg strain (ATCC VR-601), isolated from the lung of a human psittacosis patient (140).
Chlamydial culture and purification of EBs: L-suspension cell line was used for
multiplying C. psittaci strains (50, 194). The cells were maintained in Eagle’s minimum
essential medium-1 (MEM-1) (Nissui, Japan) containing 5% fetal bovine serum (FBS) and
10 µg/ml of gentamicin. The EBs were harvested 3 to 4 days after inoculation and partially
purified as described in CHAPTER II by procedure reported by Tamura and Higashi (194).
The aliquots were stored at -80°C and later were used for determining stock EB
concentrations and for mice inoculations. The aliquots once thawed were not used again.
Quantification of EBs: The EB concentration in the stock was determined by
counting inclusion-forming units (IFU). Two-fold serially diluted, 200 µl suspension of
each strain was inoculated in duplicate on confluent McCoy cell monolayers grown (as
described in CHAPTER II) on 14 mm diameter glass round cover slips in 24 well plate
(Nunc, Roskilde, Denmark). After 24 hr of incubation at 37°C in 5% CO2, the coverslips
were fixed in chilled acetone for 10 min at 4°C and then stained with chlamydia group
specific fluorescein isothiocyanate (FITC)-labeled Mab (Denka Seiken Co. Ltd, Tokyo,
![Page 69: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/69.jpg)
64
Japan). IFU were counted in duplicate slips by using fluorescent microscope (Olympus,
model BX50, Tokyo, Japan) using 200 times magnification and concentrations of EBs in
the stocks were calculated.
Mice: Specific pathogen free, female, 6 to 8 weeks old BALB/c mice were
obtained from Japan SLC Inc. (Shizuoka, Japan). The mice were kept in filtered top cages
in isolators under sterilized conditions. The mice were housed under standard
environmental conditions and received sterilized food and water ad libitum in accordance
with the guidelines for animal experiments at Gifu University.
Experimental design and inoculations: Total 96 mice were divided into 4 groups,
each consisting of 24 mice for each of 4 C. psittaci strains. With in each group, 4 mice
were inoculated with single dose and kept together in one cage. Mice were inoculated with
0.5 IFU, 5 IFU, 50 IFU, 5!102 IFU, 5!10
3 IFU and 5!10
4 IFU per gm body weight. Mice
were inoculated intranasally using 2 µl of inoculum per gram body weight with designated
concentration of EBs. A group of 6 mice, inoculated with same volume of MEM, was kept
as control. Mice were observed for 21 days post inoculation. The LD50 was calculated as
the method of Reed and Muench (154). Lung, liver, spleen and heart tissues were collected
from mice died before 21 days and those survived after 21 days post inoculation, in PBS,
pH 7.4 for DNA extraction and in sucrose-phosphate-glutamate (SPG) medium (218 mM
sucrose, 3.8 mM KH2PO4, 4.9 mM K2HPO4, 4.9 mM L-glutamic acid, pH 7.4) (17)
containing kanamycin 100 µg/ml, streptomycin 50 µg/ml, gentamicin 10 µg/ml and
vencomycin 100 µg/ml for determining chlamydial burden in lung, liver and spleen. The
blood samples were also collected from survived animals for serum extraction and
measuring IgG. The experiment was repeated twice with 5!102 and 5!10
3 IFU dose rates
with the same procedure.
Quantification of chlamydial burden: The 20% suspensions of lung, liver and
![Page 70: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/70.jpg)
65
spleen tissues in SPG were centrifuged at 1,000 ! g for 10 minutes at 4°C. After
appropriate dilutions, 200 µl of supernatant was inoculated in duplicate on confluent
McCoy cell monolayer grown on glass coverslips in 24 well plate and incubated for 24 hr
at 37°C in 5% CO2. The coverslips were fixed in chilled acetone and IFU were counted by
the same procedure as mentioned in EB quantification protocol using chlamydia group
specific FITC-labeled Mab (Denka Seiken Co. Ltd, Tokyo, Japan).
DNA extraction and nested PCR: The DNA from lung, liver and spleen tissues of
mice was extracted by phenol-chloroform-isoamyl procedure (171) and nested PCR was
done as reported before (33) for detecting the chlamydial DNA to ascertain the clearance
of infection after 21 days post inoculation at different inoculation dose levels of all 4
strains.
Microimmunofluorescence test: The chlamydia specific IgG were detected by
microimmunofluorescence test as described before (156, 169) with some modifications.
Briefly McCoy cells were grown on Teflon coated 24 well glass plates (Cel-line; Erie
Scientific Co., Newfield, New Jersey, USA.) by adding 20 µl of suspension containing 105
cells/ml of MEM-1 with 5% FBS on each well and incubating for 24 hr at 37°C in 5% CO2
under moist conditions. Then after washing slides with MEM-1, 20 µl of suspension
containing 105 IFU of C. psittaci per ml of MEM-1 with 5% FBS and 1 µg/ml of
cycloheximide was added on each well of the glass slides and incubated under moist
conditions at 37°C in 5% CO2 for 24 hr. Then after removing medium, the slides were air
dried and fixed with acetone for 20 min. Then 20 µl of two fold serially diluted serum,
starting from 1:8, was placed on each well and incubated for 60 min at 37°C in moist
chamber. After washing thrice with chilled PBS, pH 7.4, the slides were incubated with
ICN/Cappel FITC-labeled sheep anti-mouse IgG (whole molecule) (ICN Biomedicals, inc.
Aurora, Ohiyo, USA) for 60 min. The slides were washed again thrice with chilled PBS,
![Page 71: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/71.jpg)
66
pH 7.4 followed by washing with water and finally observed under fluorescent microscope
(Olympus, model BX50, Tokyo, Japan) at 200 time magnification after mounting in
SlowFade light antifade solution (Molecular Probes, Eugene, Oregon, USA).
Preinoculation and serum of negative control mice were used as negative control.
Statistical analysis: The analysis of body weight variation among different groups
of mice was done by comparing them with control group at different time points using two
tailed Student’s t-test and Mann-Whitney U-test. Results were considered significantly
different at the level of P value <0.05.
RESULTS
Different indices of virulence like the patterns of appearance/resolution of clinical
signs, body weight variations, mortalities and seroconversions at different doses of
inoculations with Nosé, MN, Mat116 and Borg strains of C. psittaci were monitored. The
data of repeated experiments was pooled in final analysis.
Clinical signs: The mice were observed for appearance of clinical signs like
general weakness, lethargy, ruffling of fur and respiratory signs. The scoring and pattern of
clinical sign are shown in Fig. 12. The appearance of clinical signs started on second to
third day post inoculation and the intensity was peaked at 4 to 5 days and persisted up to 9
to 10 days post inoculation among all 4 strains. At the dose rate of 5!103 and 5!10
4
IFU/gm body weight, all 4 strains showed the same intensity of clinical signs but at 50 and
5!102 IFU/gm body weight dose rate, MN showed milder clinical signs as compared to
Nosé, Mat116 and Borg strains. No clinical signs or very mild and transient signs of
disease were observed in all strains at dose of 0.5 and 5 IFU/gm body weight. The
resolution of clinical signs started after 12 days post inoculation and complete recovery
![Page 72: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/72.jpg)
67
Fig. 12. The bar diagrams showing the patterns of appearance and resolution of clinical
signs in BALB/c mice inoculated intranasally with 0.5 IFU, 5 IFU, 50 IFU, 5!102 IFU,
5!103 IFU and 5!10
4 IFU per gram body weight with Nosé, MN, Mat116 and Borg
strains of C. psittaci. The 0-day indicates inoculation day and animals were observed for 21
days. The score 0: no clinical signs or normal, 1: mild weakness, lethargy and ruffling of
fur, 2: weakness, lethargy and ruffling of fur, 3: severe weakness, lethargy and ruffling of
fur along with labored breathing and hunched back, 4: death. The numbers of mice died
out of total inoculated are shown in the parentheses for each dose and strain. The control
group (inoculated with MEM-1) did not show any clinical signs. Each bar represents data
of a single mouse at particular time point.
![Page 73: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/73.jpg)
0 3 6 9 12 15 18 21
Score
Score
0 3 6 9 12 15 18 21
Days
0 3 6 12 15 18 21
0 3 6 9 12 15 18
219
Score
0 3 6 12 15 18
21
9
0 3 6 12 15 189
0 3 6 12 15 18 219
0 3 6 12 15 18 219
Days
0 3 6 12 15 18 219
0 3 6 12 15 18 219
0 3 6 12 15 18 219
0 3 6 12 15 18 219
Days
Score
0 3 6 12 15 18 219
0 3 6 12 15 18 219
0
1
2
3
4
Sco
re
0 3 6 12 15 18 219
0
1
2
3
4
50 I
FU
Sco
re
0 3 6 12 15 18 219
Nosé MN Mat116 Borg
Days
Score
0
1
2
3
4
5 IF
U
Sco
re
0 3 6 12 15 18 219
0 3 6 12 15 18 219
0 3 6 12 15 18 219
0 3 6 12 15 18 219
0 3 6 12 15 18 219
0 3 6 12 15 18 219
0 3 6 12 15 18 219
0.5
IFU
Score
0
1
2
3
4
Sco
re
0 3 6 12 15 18 219
0
1
2
3
4
Sco
re
0
1
2
3
4
Sco
re
5×10
2 IF
U5×
103 I
FU
5×10
4 IF
U
21
(0/4) (0/4) (0/4) (0/4)
(0/4) (0/4) (0/4) (0/4)
(0/4) (0/4) (0/4) (0/4)
(0/8) (0/8) (2/8) (1/8)
(5/8) (2/8) (2/8) (3/8)
(4/4) (2/4) (2/4) (4/4)
![Page 74: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/74.jpg)
69
Fig. 13. Mean relative body weight variations among the BALB/c mice inoculated with Nosé,
MN, Mat116 and Borg strains of C. psittaci. Mice were inoculated with 0.5 IFU (— line), 5
IFU (— line), 50 IFU (— line), 5!102 IFU (— line), 5!10
3 IFU (— line) and 5!10
4 IFU
(—line) per gram body weight on 0-day and observed for 21 days post infection. At each
time point, represented by 4 to 8 mice, P <0.05 was compared to control group (inoculated
with MEM-1 and shown by — line) using Student’s t-Test and Mann-Whitney U-Test. The
statistically significant time points are marked with asterisk (*). The error bar shows the
standard error. The points of mortality are shown by delta marks (") and its numbers
represent mice died at that point of time.
![Page 75: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/75.jpg)
(A) Nosé strain
(B) MN/cal110 strain
![Page 76: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/76.jpg)
(C) Mat116 strain
(D) Borg strain
![Page 77: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/77.jpg)
72
was observed before 21 days, when experiment was terminated (Fig. 12).
Relative body weight variations: The relative body weight variations after the
inoculation with each strain is shown in Fig. 13. MN strain showed less variation in the
relative body weight at higher doses as compared to Nosé, Mat116 and Borg strains.
Mortality pattern and LD50: All the 4 strains were lethal to BALB/c mice at
various dose rates. No particular pattern of mortality was observed among all 4 strains. The
LD50 of Nosé, MN, Mat116 and Borg were observed to be 3.1!103, 19!10
3, 12!10
3 and
6.3!103 IFU/gm body weight, respectively.
Chlamydial burden among dead and recovered mice: To study the
pneumotropism and lethal lung burden, chlamydial EBs per gram of lung tissue of dead
mice were determined among mice inoculated with 5!103
IFU/gm body weight. At this
dose rate both mortalities and recoveries of mice were observed in all 4 strains. Among all
4 strains Borg strains multiplied in murine lung tissues rapidly and reached to the level of
35.7 ! 105 to 71.9 ! 10
5 IFU/gm body weight (Table 13). Among dead mice, infection also
spread to other primary organs like liver and spleen but the extent of multiplication was
found less than the primary target organ (lung).
Clearance of chlamydial infection: Samples from all dose level from all strains
were also screened by nested PCR to test the clearance of chlamydial infection from lung
liver and spleen after 21 days of infection. All samples except one infected with Nosé
strain, were found PCR negative (Table 13). This indicated that all the C. psittaci strains
irrespective of genetic group followed the same disease pattern in murine lung infection
model.
Chlamydia specific IgG immune response: The geometric mean titers of the
chlamydia specific IgG among recovered mice are shown in Table 14. The data showed
dose dependent increase in IgG tires among all 4 strains. It also showed that even lowest
![Page 78: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/78.jpg)
73
Table 13. Chlamydial burden in lung, liver and spleen among the recovered and dead BALB/c
mice, inoculated intranasally with 5!103 IFU/gm body weight of Nosé, MN, Mat116 and Borg
strains of C. psittaci.
Strains Micea Chlamydia burden
b Anti-
chlamydial
Lung Liver Spleen IgG titers
IFU/gm PCRc IFU/gm PCR
c IFU/gm PCR
c
Nosé D5 <1 - - - - - 512
D6 <1 - - - - - 1!103
D18 1.2 ! 103 + <1 - <1 - 512
D7" 8.2 ! 105 + 8 !10
2 + 9.5 ! 10
2 + NT
D8" 10.5 ! 105
+ 6 ! 102 + 1.4 ! 10
3 + NT
D17" 6.5 ! 105
+ <1 + 2 ! 102 + NT
D19" 4.4 ! 105 + 1.2 ! 10
3 + 1.5 ! 10
2 + NT
D20" 6.4 ! 105 + 2.5 ! 10
2 + 1.5 ! 10
2 + NT
MN C5 <1 - <1 - <1 - 256
C6 <1 - <1 - <1 - 256
C8 <1 - <1 - <1 - 512
C17 <1 - <1 - <1 - 128
C19 <1 - <1 - <1 - 256
C20 <1 - <1 - <1 - 256
C7" 8 ! 105
+ 9.5 ! 102 + 1.1 ! 10
3 + NT
C18" 2.9 ! 105 + 5 ! 10
2 + 4 ! 10 + NT
Mat116 A7 <1 - <1 - <1 - 256
A8 <1 - <1 - <1 - 512
A17 <1 - <1 - <1 - 256
A18 <1 - <1 - <1 - 1!103
A19 <1 - <1 - <1 - 1!103
A20 <1 - <1 - <1 - 512
A5" 7.8 ! 105 + 8.5 ! 10
2 + <1 + NT
A6" 14.4 ! 105 + <1 + 2 ! 10
2 + NT
A14" 11.4 ! 105 + 1 ! 10
4 + 8.2 ! 10
3 + NT
Borg B6 <1 - - - - - 512
B8 <1 - - - - - 256
B17 <1 - <1 - <1 - 1!103
B18 <1 - <1 - <1 - 512
B20 <1 - <1 - <1 - 512
B5" 53.1 ! 105 + 1 ! 10
3 + 3.5 ! 10
3 + NT
B7" 71.9 ! 105 + 1.9 ! 10
3 + 4.7 ! 10
3 + NT
B19" 35.7 ! 105 + 7.2 ! 10
3 + 2 ! 10
3 + NT
a Dead mice are marked by asterisk.
b IFU count is the averages of duplicate samples and shown as numbers per gram of tissue and less
than one (<1) indicates no IFU in 200µl of 20% tissue suspension. c PCR positive samples are shown as plus sign (+) and PCR negative samples as negative signs (-).
Samples of all recovered mice, sacrificed after 21 days post infection, were found PCR negative for
all dose groups.
NT indicates not tested.
![Page 79: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/79.jpg)
74
Table 14. Geometric mean of IgG titers detected among recovered BALB/c mice after intranasal
inoculation with C. psittaci strains. The numbers of tested sera (n) are given in parentheses.
C. psittaci Dose per gram body weight
a
strains
0.5 IFU 5 IFU 50 IFU 5!102 IFU 5!10
3 IFU 5!10
4 IFU
Nosé 65.5 (n=4) 138.8 (n=4) 372.2 (n=4) 421.0 (n=8) 608.9 (n=3) All mice died
MN 11.3 (n=4) 22.6 (n=4) 107.6 (n=4) 152.2 (n=8) 256.0 (n=6) 512.0 (n=2)
Mat116 22.6 (n=4) 26.9 (n=4) 53.8 (n=4) 143.7 (n=6) 512.0 (n=6) 724.1 (n=2)
Borg 9.5 (n=4) 26.9 (n=4) 53.8 (n=4) 312.1 (n=7) 512.0 (n=5) All mice died
a The dose rate is inclusion forming units (IFU) per gram body weight of mouse.
dose of 0.5 IFU/gm body weight can leads to seroconversion among inoculated mice.
DISCUSION
The financial losses resulting from the C. psittaci infections, particularly those in
the poultry and pet industries, combined with the fact that this is the most common animal
chlamydiosis transmissible to human beings, highlights the economic importance and
public health significance of the avian chlamydiosis (39, 115, 146, 181). Recent molecular
epidemiological studies have shown the genetic variations among C. psittaci strains (33,
51, 79, 191, 205). It was also observed that though many strains are prevalent among avian
fauna, only few types of strains are predominantly responsible for avian chlamydiosis
outbreaks and human psittacosis cases (33) (CHAPTER II). Therefore, to know the relative
virulence of the 4 representative strains of C. psittaci, we used BALB/c mouse model as it
would not affect the avian species specific pathogenicity of some strains and results may
be more representative of the virulence to non-avian hosts i.e. zoonotic infection of human
beings. Furthermore, in this study, intra nasal route of inoculation was used with varying
![Page 80: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/80.jpg)
75
doses to simulate the natural route of infection (mostly infection is by inhalations of
infectious aerosol) (142) and extent of exposure which represent the amount of infectious
material inhaled that is related to the final outcome human psittacosis infection (140, 197,
224).
It was observed that the Nosé strain that represent a group of strains, mostly
prevalent among psittacine birds, is most lethal to the BALB/c mice. The various reports in
the literature concerning human psittacosis and horizontal transmission of infection to in-
contact animals, support our findings that similar or closely related types of strains are
highly virulent and transmissible to non-avian hosts (37, 68, 107, 116, 197, 209, 211, 224).
The second most lethal strain to mice was Borg, which represents C. psittaci strains mostly
prevalent among poultry birds. This type of strains may be associated with human
psittacosis cases in the poultry-industry workers (8, 117, 127, 146). Two other strains,
Mat116 and MN/cal10 were also found to be lethal to BALB/c mice only at higher dose
rate, suggesting that such strains can be potentially pathogenic to avian and non avian hosts
when the exposure to the source of infection is prolonged.
The monitoring of appearance and resolution of clinical signs during the course of
disease, at varying doses of inoculation, also indicated that Nosé and Borg strains produce
severe clinical disease in mice even at lower dose rate as compared to MN. Therefore, the
C. psittaci strains of these genetic groups may induce clinical disease among in-contact
human or other mammalian hosts even after brief exposure to the source of infection.
However, similarity in the pattern of appearance/resolution of clinical signs in all tested 4
strains indicated that the disease pathogenesis and protective immune response mounted by
hosts to all types of C. psittaci strains in murine lung infection model may be the same.
This was further confirmed by testing IgG immune response and chlamydial burden in
lung, liver and spleen among recovered and died mice. It showed that IgG titers are dose
![Page 81: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/81.jpg)
76
dependent and chlamydial infection is almost cured within 21 days. The IgG also appear at
10 to 14 days of infection in mice, experimentally infected with human biovars of C.
trachomatis and C. pneumoniae (73, 104, 223). The variations in levels of morbidity and
mortality indicate that, though the pattern of resolution of infection is the same in all C.
psittaci strains, the level of protection to primary infection is variable. It may be due to the
difference in virulence factors associated with infecting strain.
Human psittacosis is not a major public health problem in term of numbers of cases
reported but it remains an important occupational hazard to the workers of poultry
industries, pet shops or aviaries staff, veterinarians and avian pets owners (39, 115, 146).
Many cases of human psittacosis occur without any history of avian contacts. Therefore, it
is necessary to test for C. psittaci in suspected cases of psittacosis and atypical pneumonia
(39, 224). Our study will provide a platform for further studies to identify the virulent
factors associated with highly pathogenic strains for better protection of avian and human
health.
SUMMARY
For evaluating the degree of virulence of C. psittaci strains predominantly
responsible for avian chlamydiosis and human psittacosis, BALB/c mice were used as
experimental infection model. Four representative C. psittaci strains: Nosé, MN, Mat116
and Borg were intranasally inoculated at dose rate of 0.5 IFU, 5 IFU, 50 IFU, 5!102 IFU,
5!103 IFU and 5!10
4 IFU per gram body weight and different parameters of virulence
were monitored. The LD50 of Nosé, MN, Mat116 and Borg strains were 3.1!103, 19!10
3,
12!103 and 6.3!10
3 IFU/gm body weight, respectively. The intensity of clinical signs
against the infectious doses of 5!103 and 5!10
4 IFU/gm body weight was the same among
![Page 82: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/82.jpg)
77
the 4 strains, however, at 50 and 5!102 IFU/gm body weight doses, the MN strain showed
milder clinical signs. The animals inoculated with the MN strain at higher doses also
showed less variations in the relative body weights as compared to those inoculated with
Nosé, Mat116 and Borg strains. Among the 4 strains, Borg strain rapidly multiplied in
murine lung tissues and infection reached up to 35.7 to 71.9 ! 105 IFU/gm body weight
level at the point of death. Lateral spread of infection to other primary organs including
liver and spleen was also observed. The complete recovery and clearance of chlamydial
infection was verified at 21 days post infection by detecting chlamydial DNA and/or
chlamydial IFU in lung, liver and spleen tissues. Chlamydia specific IgG immune response
was found to be dose dependent. This study indicated that the C. psittaci strains frequently
associated with avian and human psittacosis cases were highly virulent to mice and that the
immune responses lead to variable degrees of protection. Our murine lung infection model
can be used for further virulence analysis studies at molecular level.
![Page 83: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/83.jpg)
78
PART II
Investigation of the Emergence of Chlamydial Infection Among Animals and
Human Disease Conditions
![Page 84: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/84.jpg)
79
Involvement of multiple Chlamydia suis genotypes in porcine conjunctivitis
in commercial farms of Japan
INTRODUCTION
Porcine chlamydial infections are either clinical or subclinical in nature. In the past,
Chlamydia trachomatis like strains were detected from various types of porcine specimens
in USA (99, 165, 183). These genetically distinct and host specific strains have been
classified as Chlamydia suis under family Chlamydiaceae in recent classification on the
basis of 16S rRNA gene (43). C. suis has been mainly detected either from conjunctivitis,
pneumonitis, pericarditis, vaginitis, mastitis and enteritis cases or from lymph nodes,
semen, feces and lungs of normal pigs (82, 84, 99, 166, 196). Other chlamydiae such as
Chlamydophila abortus, Chlamydophila pecorum, Chlamydophila psittaci and Chlamydia-
like organisms are also reported in pigs with respiratory and reproductive tract disorders,
polyarthritis and semen from healthy boars (82, 84, 178, 179, 196). Mixed infection of C.
suis with C. pecorum in aborted porcine fetal livers, and with C. abortus in intestinal,
respiratory and reproductive tract samples have also been reported (82, 179).
Epidemiological studies on porcine chlamydiosis have indicated high prevalence
rate among sick and normal pigs in Germany (82, 84), USA (95, 165) and Switzerland
(178, 179). Recent studies have also indicated prevalence of chlamydial infection among
both male and female porcine used for breeding purpose in Belgium, Germany and
Switzerland (100, 196, 211). In Japan there is only one report of abortion due to
Chlamydia psittaci in a pig farm (139) and another report of prevalence of complement
CHAPTER-IV
![Page 85: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/85.jpg)
80
fixing antibodies among 0.7% pig samples (58). There is no study that has identified
involvement of specific chlamydial species or strain in the porcine clinical infections.
For detection and identification of chlamydial species, 16S-23S ribosomal RNA
intergenic spacer region was reported as a suitable target (41, 44). The ompA gene that
encodes MOMP is also the most preferred target for chlamydial epidemiological studies
and analysis of genetic diversity of the chlamydiae detected directly from field samples
(33, 82, 96). Chlamydial ompA gene consists of genetically conserved domains (CD)
flanking 4 genetically variable domains (VD). The VDs of ompA gene are reported to have
species/strain specific sequences, which encode immunologically specific epitopes on
MOMP (12, 98). Genetic analysis of ompA gene of C. suis strains of lungs and intestinal
origin has shown 20% nucleotide variation (82).
In the present study, the etiology of frequent conjunctivitis incidences and some
reproductive disorder cases occurring among 5 commercial farms in 3 prefectures of Japan
was investigated. Initial screening was done by chlamydia group specific direct fluorescent
antibody test (FAT) on impression smears. Then followed by nested PCR tests targeting
16S-23S rRNA intergenic spacer region and ompA gene for detection, identification and
analysis of genetic diversity in chlamydial spp./strains. Complement fixation test (CFT)
was done to screen serum samples. Diverse C. suis genotypes were identified among
conjunctivitis cases by nucleotide sequences analysis of 16S-23S rRNA intergenic spacer
and ompA gene fragments.
MATERIALS AND METHODS
Samples analyzed: A total of 61 samples were taken from 49 animals of 5
commercial pig farms in 3 prefectures of Japan from 2003 to 2005. The samples were 35
![Page 86: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/86.jpg)
81
ophthalmic swabs taken from pigs with mucopurulent conjunctivitis and
keratoconjunctivitis (Fig. 14), 9 vaginal swabs from aborted animals, 2 tonsilar swabs and
3 seminal fluid samples from breeding boars. Twelve serum samples were also collected
(Table 15).
Table 15. List of the farms and samples analyzed.
Farms (prefectures) Disease condition Type of Sample
samples no.
Farm-I (Chiba) Conjunctivitis Eye swabs 10
Normal Tonsillar swabs 2
Farm-II (Miyagi) Conjunctivitis Eye swabs 10
Abortion Vaginal swabs 9
Normal Seminal fluid 3
Abortion and normal Serum samples 12
Farm-III (Kanagawa) Conjunctivitis Eye swabs 5
Farm-IV (Kanagawa) Conjunctivitis Eye swabs 5
Farm-V (Kanagawa) Conjunctivitis Eye swabs 5
Total 61
Chlamydial and other bacterial species: For standardizing the PCR test, DNA
was extracted from S45 strain of C. suis (ATCC VR 1474) and other Chlamydophila spp.
viz. C. psittaci- 6BC and MN strains, C. felis- FePn Baker strain, C. abortus- B577 strain
and C. caviae- GPIC strain. DNA of Escherichia coli, Staphylococcus aureus,
Pseudomonas sp., and Proteus sp. was also extracted and used for testing specificity of the
PCR. The chlamydial and bacterial strains were obtained from the Laboratory of
Veterinary Microbiology, Gifu University, Japan.
Complement fixation test (CFT): Total 12 serum samples collected from a pig
farm (farm-II, Table 15) were tested by CFT using Chlamydia psittaci CFT kit (Denka
Seiken Co. Ltd, Tokyo, Japan) according to the instructions of the manufacturer.
![Page 87: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/87.jpg)
82
Fig. 14. A domesticated pig (Farm-I, Sample ID PG18) with keratoconjunctivitis and
mucopurulent ocular discharge tested C. suis. positive by nested PCR.
Direct fluorescent antibody test (FAT): Total 9 ophthalmic swabs and 9 vaginal
swabs were stained by chlamydia group specific FITC-coupled Mab (Denka Seiken Co.
Ltd, Tokyo, Japan) according to the manufacture’s protocol and chlamydial elementary
bodies (EBs)/inclusions were observed by fluorescent microscope (Olympus, model BX50,
Tokyo, Japan) using 200 times magnification.
DNA extraction: DNA was extracted using SepaGene DNA extraction kit (Sanko
Junyaku, Tokyo, Japan) following manufacture’s instructions. Briefly ophthalmic, vaginal
and tonsillar swabs or 200 µl of seminal fluid were resuspended in 700 µl of phosphate-
buffered saline (PBS) pH 7.4 and centrifuged at 16,000 ! g for 30 min at 4°C and
sediments were processed further for DNA extraction. DNA pallets were finally
![Page 88: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/88.jpg)
83
resuspended in 30 µl of Tris-EDTA (TE) pH 7.4 (100 mM Tris-HCl, pH 7.4 and 10 mM
EDTA, pH 8.0) and stored at -30°C until use.
Nested PCR tests: The PCR test targeting 16S-23S rRNA intergenic spacer region
was done as reported before (41, 44) with some modifications. 16SF2 and 23R primers
were used as outer pair and 16SF3 and IGR as inner pair to amplify 16S-23S rRNA
intergenic spacer segment. The Chlamydophila genus specific test was also performed as
reported before (33). Chlamydia genus specific nested PCR was standardized in this study.
The oligonucleotide primer sequences used in the study are shown in Table 16. PCR
primers were synthesized by Rikaken Co., Nagoya, Japan. The conditions for maximum
DNA amplification were adjusted using variable annealing temperatures, primer
concentrations and thermocycling conditions. All the PCR tests were performed in 50 µl
reaction mixture containing 0.20 µM of each forward and reverse primers, 250 µM of each
dATP, dTTP, dGTP, dCTP, 100 µM of Mg2+
in buffer and 2.5 units of TaKaRa Ex-Taq
(Takara Bio Inc., Shiga, Japan) and 2.0 to 5.0 µg of template DNA of each sample. DNA
of C. suis S45 strain was used as a positive control. Five microliters of the first step PCR
product was used for the second step PCR. The thermocycling conditions used in both
steps of Chlamydia genus specific PCR were: 3 min at 94°C then 35 cycles of 30 sec at
94°C, 20 sec annealing at 58°C and extension for 90 sec at 72°C (60 sec in second step
PCR), followed by 5 min at 72°C and soaking at 4°C. For the amplification of 16S-23S
rRNA intergenic spacer region, same thermocyclic conditions were used except annealing
for 30 sec at 55°C (50°C in second step PCR) and extension of 60 sec at 72°C (30 sec in
second step PCR) during 35 cycles. PBS and water were used as negative controls.
Sensitivity and specificity were verified under the determined conditions with DNA
templates of different bacteria and Chlamydophila spp.
![Page 89: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/89.jpg)
Table 16. Oligonucleotide primers used in the study.
Primer name Nucleotide sequence Positionsa
Melting Reference
temperature (°C)
16S-23S rRNA intergenic spacer regionb:
16SF2 5'-CCGCCCGTCACATCATGG-3' 1398-1415 (16S rRNA) 60-62 (41)
23R 5'-TACTAAGATGTTTCAGTTC-3' 212-193 (23S rRNA) 47-49
16SF3 5'-TCGTAACAAGGTAGCCC-3' 1496-1512 (16Sr RNA) 52-54
IGR 5'-AGCTCTTA(T/G/A)(C/T)AACTTGGTCTGTA-3' 23-1 (23S rRNA) 53-55 (44)
ompA gene:
Genus Chlamydia specific This study
CS-1PF 5'-GGAATCCTGCTGAACCAAGCCTTATGAT-3' 77-104 61-63
CS-1PR 5'-GCGAGTCTCAACAGTAACTGCGTATT-3' 1107-1082 60-62
CS-2PF 5'-GGCGTTGAATATTTGGGATCGTTTTG-3' 366-391 58-60
CS-2PR 5'-CTTGCTCGAGACCATTTAACTCCAATG-3' 872-846 59-61
Genus Chlamydophila specific (33)
CMGP-1F 5'-CCTTGTGATCCTTGCGCTACTTG-3' 138-159 60-62
CMGP-1R 5'-GTGAGCAGCTCTTTCGTTGAT-3' 1184-1164 57-60
CMGP-2F 5'-GCCTTAAACATCTGGGATCG-3' 384-403 56
CMPG-2R 5'-GCACAACCACATTCCCATAAAG-3' 634-613 57
a The positions of the primers are based on the ompA gene sequence of Chlamydia suis, PCLH197 strain (accession no. AJ440241) and
Chlamydophila psittaci, 6BC strain (accession no. X56980).b The primer positions are based on 16S rRNA and 23S rRNA genes of R22 strain of C. suis (accession no. U68420).
![Page 90: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/90.jpg)
85
Cloning of PCR product and sequencing: The second step PCR products were
purified by gel electrophoresis using low melting agarose gel in Tris-acetate-EDTA (TAE)
buffer, pH 7.4 followed by QIAquick Gel Extraction kit (Qiagen, Hilden, Germany). The
DNA fragments were cloned in pGEM-T vector (Promega, Madison, Wisconsin) and
DH5! strain of E. coli (Tyobo Co., Osaka, Japan) was transformed by heat shock method
(171). From each PCR product, 5 clones with expected size DNA insert were taken for
sequencing. The sequencing was done using the dye-terminator method and performed by
a commercial resource (Dragon Genomics Co., Mie, Japan). Both strands were read. The
sequences were assembled and edited using Genetyx-Mac/ATSQ 4.2.3 and Genetyx-Mac,
version 13.0.6 (SDC, Tokyo, Japan).
Analysis of sequences and construction of phylogenetic trees: The chlamydial
species and strains were identified by NCBI-BLAST (http://www.ncbi.nlm.nih.gov) search
of nucleotide sequences of 16S-23S rRNA spacer region and ompA gene. For phylogenetic
analysis, the 16S-23S rRNA spacer region and ompA gene sequences of C. suis strains and
each representative species of genus Chlamydia were retrieved from the DDBJ. Multiple
alignments of the trimmed sequences were done using ClustalX, version 1.83 (198).
Phylogenetic analysis was done with programs in the PHYLIP (version. 3.6a3;
[http://evolution.genetics.washington.edu/phylip.html]). The distance matrix between
species was computed by DNADIST and clustering of lineages was done by NEIGHBOR
using neighbor-joining method. The bootstrap values were calculated to evaluate the
branching reliability of trees from a consensus tree constructed by generating 1,000
random data sets using SEQBOOT.
![Page 91: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/91.jpg)
86
RESULTS
Epidemiological studies: In the preliminary screening, impression smears from
conjunctival swabs (n=9) and vaginal swabs (n=9) from animals with severe clinical signs
were examined with FAT. Chlamydial EBs and/or inclusions were detected from 33.3% (3
out of 9) conjunctivitis samples only. Then all the samples (n=49) were examined by using
nested PCR tests. By 16S-23S rRNA intergenic spacer and Chlamydia genus specific PCR,
22 out of 49 (44.9%) samples were found positive. All PCR positive samples were accrued
from conjunctivitis cases. In the conjunctivitis cases, 22 out of 35 (62.9%) ophthalmic
swab samples were positive including all those which were FAT positive. All samples
were found negative by Chlamydophila genus specific nested PCR. No chlamydial
infection was detected among samples from tonsillar swabs (Table 17).
Table 17. The 16S-23S rRNA intergenic spacer and ompA gene based nested PCR results for detection of
Chlamydia species and Chlamydophila species.
Farms Type of
Total
samples PCR positive sample
Chlamydial
species
samples tested Intergenic Chlamydia Chlamydophila identified
spacer
primers
specific
primers
specific
primers
Farm-I Eye swabs 10 6 (60%) 6 (60%) 0 C. suis
Tonsillar
swabs 2 0 0 0
Farm-II Eye swabs 10 3 (30%) 3 (30%) 0 C. suis
Vaginal swabs 9 0 0 0
Seminal fluid 3 0 0 0
Farm-III Eye swabs 5 4 (80%) 4 (80%) 0 C. suis
Farm-IV Eye swabs 5 5 (100%) 5 (100%) 0 C. suis
Farm-V Eye swabs 5 4 (80%) 4 (80%) 0 C. suis
Total 49 22 (44.9%) 22 (44.9%)
![Page 92: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/92.jpg)
87
The vaginal swab samples from 9 aborted sows and seminal fluid from 3 breeding
boars were found negative by all PCR tests. The serum samples analysis of these 12
animals (aborted sows=9 and normal breeding boars=3) by CFT showed 5 aborted sows
with antichlamydial immmunoglobulins titers of more than 1:8 (1:8 for 2 animals and 1:16
for 3 animals) indicating possible non-chlamydial etiology of current reproductive
problems but may have previously exposed to the chlamydial infection.
Genetic variation analysis: The analysis of 238 to 241 bp nucleotide sequence of
16S-23S rRNA intergenic spacer region of all PCR positive samples by NCBI-BLAST
(http://www.ncbi.nlm.nih.gov) search and phylogenetic clustering in NJ tree confirmed the
involvement of C. suis (Fig. 15 and Table 17). Total 9 variants of 16S-23S rRNA
intergenic spacer region nucleotide sequences with less than 3% differences were found
(Fig. 16) and were designated as sequence types (Table 18-a). To further confirm the
genetic diversity among C. suis strain involved in clinical cases of conjunctivitis,
nucleotide sequence analysis of ompA gene fragment of 454 to 463 bp that includes VD2
and VD3 regions was done. Two PCR positive samples from each farm, including those
with multiple 16S-23S rRNA intergenic spacer region nucleotide sequences, were
randomly selected and sequenced. Twenty types of nucleotide sequences (sequence types)
were detected (Table 18-b). All the C. suis strains showed up to 22% nucleotide variations
in the sequenced region.
The predicted amino acid sequence alignment of all the detected and already
known C. suis strains in the sequenced fragment of ompA gene (151 to 154 amino acids)
revealed the high genetic variations in the form of amino acid substitutions, insertions and
deletions leading to gaps formation (varies from 0 to 3 in numbers) in VD2 along with
some conserved motifs of amino acid residues in VD2 and VD3 region (Fig. 17).
On the basis of the sequence variation in 16S-23S rRNA intergenic spacer region,
![Page 93: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/93.jpg)
Chlamydia muridarum-SFPD (U68437)
Chlamydia trachomatis-A/HAR-13 (CP000051)
Chlamydia trachomatis-B/TW-5/OT (U68440)
Chlamydia trachomatis-D/UW-3/CX (AE001273)
Chlamydia trachomatis-F/IC/CAL3 (U68442)
Chlamydia trachomatis- L2/434/BU (U68443)
Chlamydophila psittaci-MN (U68453)
CSR0503CSR0515
S45 (U73110)
CSR0304CSR0305
CSR0301
CSR0517, R19 (AF481047), R22 (U68420)
R24 (U68428)R27 (U68429)
H5 (U68427)
CSR0401CSR0402
CSR0505
MS04 (DQ118376)
CSR0504
CSR0511 CSR0502CSR0501CSR0507
Chlamydia muridarum-Nigg (AE002160)
0.005 units
Chlamydia suis
Fig. 15. The NJ tree of 16S-23S rRNA intergenic spacer region of detected (in bold letters) and knownstrains of C. suis showing separate grouping in relation to the C. trachomatis and C. muridarum species. The branch of C. psittaci is reduced three times. The accession numbers of the detected C. suis strains are: CSR0301-AB283016, CSR0303-AB283017, CSR0304-AB283018, CSR0305-AB283019, CSR0401-AB283006, CSR0402-AB284054, CSR0501-AB283007, CSR0502-AB283008, CSR0503-AB283009, CSR0504-AB283010, CSR0505-AB283011, CSR0507-AB283012, CSR0511-AB283013, CSR0515-AB283014, CSR0518-AB283015 and those of known species and strains are shown against each strain in parentheses in figure. The bootstrap values are shown against each node. The relative genetic distance isshown in 0.005 unit bar.
CSR030393%
54.4%99.8%
99.8%
75%
61.8%
![Page 94: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/94.jpg)
![Page 95: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/95.jpg)
90
Table 18. Distribution of C. suis sequence types in different farms and animals based on (a) 16S-23S rRNA
intergenic spacer region and (b) ompA gene. The ompA gene based genotypic clusters depending on gaps in
the VD2 region are also shown.
(a) 6S-23S rRNA intergenic spacer region
Farms (prefectures) Sample IDa Sequence
b Strains Accession no.
types
Farm-I (Chiba) PG18 1 CSR0301 AB283016
PG21 1 CSR0303 AB283017
2 CSR0304 AB283018
3 CSR0305 AB283019
Farm-II (Miyagi) PG1 4 CSR0401 AB283006
PG2 4 CSR0402 AB284054
Farm-III (Kanagawa) PG5 4 CSR0501 AB283007
5 CSR0502 AB283008
6 CSR0503 AB283009
7 CSR0504 AB283010
PG6 4 CSR0505 AB283011
Farm-IV (Kanagawa) PG7 4 CSR0507 AB283012
PG8 4 CSR0511 AB283013
Farm-V (Kanagawa) PG9 8 CSR0515 AB283014
PG10 9 CSR0518 AB283015
(b) ompA gene
Farms (prefectures) Sample IDa Sequence
b Genetic Strains Accession no.
types clusterc
Farm-I (Chiba) PG18 1 A CS0301 AB270719
2 A CS0302 AB270720
PG21 1 A CS0303 AB270721
2 A CS0304 AB270722
Farm-II (Miyagi) PG1 3 B CS0401 AB270723
PG2 3 B CS0402 AB270724
Farm-III (Kanagawa) PG5 4 A CS0501 AB270725
5 A CS0502 AB270726
6 D CS0503 AB270727
PG6 7 A CS0504 AB270728
8 A CS0505 AB270729
9 D CS0506 AB270730
Farm-IV (Kanagawa) PG7 10 A CS0507 AB270731
3 B CS0508 AB270732
11 A CS0509 AB270733
1 A CS0510 AB270734
PG8 12 D CS0511 AB270735
13 D CS0512 AB270736
14 D CS0513 AB270737
15 D CS0514 AB270738
Farm-V (Kanagawa) PG9 16 B CS0515 AB270739
17 B CS0516 AB270740
18 A CS0517 AB270741
PG10 19 D CS0518 AB270742
20 D CS0519 AB270743
a Represents the independent sample taken from the individual animal.
b The sequences with same numerical numbers are having 100% homologous nucleotide sequences. The
nucleotide sequence types with similar deduced amino acid sequences are bracketed together. c As grouped in Figs. 17 and 18.
![Page 96: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/96.jpg)
91
only 2 animals (PG21 and PG5) were found harboring multiple genotypes of C. suis (Table
18-a), but ompA gene based screening detected much more cases of multiple genotypes
infection in individual animal or farm. The distribution of different ompA gene based C.
suis genotypes detected among 5 farms and 10 animals are shown in Table 18-b, Fig. 17
and Fig. 18. One animal of farm-I and farm-III each was found to have 3 and 4 types of C.
suis. In 4 farms, each animal was found to harbor 2 to 4 types of genetically varied C. suis
strains. Whereas, only one genotype was detected among animals of farm-II. The
genetically closely related sequence types 1 and 2 were detected from 2 animals of farm-I
and one animal (PG7) of farm-IV. However, animals of farm-III and farm-V and PG7
animal of farm-IV were found harboring highly diverse genotypes. These results indicate
the high genetic variation among the C. suis stains infecting either a single animal or
prevalent in the same farm. The overall numbers of genotypes detected based on sequence
analysis of 16S-23S rRNA intergenic spacer and ompA gene are shown in Table 19.
Table 19. Number of sequence types detected in different farms and animals based on the
16S-23S rRNA intergenic spacer region and ompA gene.
Farms (prefectures) Sample IDa Sequence types
b
Intergenic spacer ompA gene
Farm-I (Chiba) PG18 1 2
PG21 3 2
Farm-II (Miyagi) PG1 1 1
PG2 1 1
Farm-III (Kanagawa) PG5 4 3
PG6 1 3
Farm-IV (Kanagawa) PG7 1 4
PG8 1 4
Farm-V (Kanagawa) PG9 1 3
PG10 1 2
a Represents the independent sample taken from the individual animal.
b The sequence types with the same numerical numbers are having 100% homologous
nucleotide sequences.
![Page 97: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/97.jpg)
92
Phylogenic analysis: All the detected and known strains of C. suis are clustered
together in a group vis-à-vis other Chlamydia spp. and representative Chlamydophila
psittaci strain in 16S-23S rRNA intergenic spacer based NJ tree (Fig. 15). For further
determination of epizootiologically predominant genotypes of C. suis, all the 25 detected
ompA gene sequences (20 variant types) were compared with all the known strains of C.
suis derived from lungs, enteric, nasal and ophthalmic samples either from healthy or
diseased animals. All the strains were broadly grouped into 4 clusters; named A, B, C and
D depending upon the numbers of gaps in the VD2 (Fig. 17 and 18). Genetic cluster A
strains have no gap whereas strains of clusters B, C and D have one, two and three gaps,
respectively in the VD2. Epizootiologically predominant clusters are D, A, C and B in
descending order. In this study, C. suis strains only belonging to genetic clusters A, B and
D could be detected. Distribution of these genetic clusters among 5 farms and screened
animals is shown in Table 18-b. The distributions of C. suis strains into 4 genetic clusters
do not related to host disease condition or tissue tropism.
DISCUSSION
C. suis is a recently identified pathogen of both domesticated and wild porcine (43,
84, 95, 165). C. suis has been demonstrated experimentally to be capable of causing acute
pneumonia (166, 167), conjunctivitis (163) and enteric lesions (164) in gnotobiotic pigs.
Limited epizootiological studies have indicated that C. suis infections in pigs are wide
spread but under diagnosed. For detection of porcine chlamydiosis particularly due to C.
suis, a sensitive ompA gene based PCR test was developed and used along with previously
reported broad range 16S-23S rRNA based PCR. In the present investigation, C. suis was
detected among 62.9% conjunctivitis samples by PCR, suggesting higher prevalence of C.
![Page 98: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/98.jpg)
93
Fig. 17. Genetic clusters of C. suis strains detected in this study and reported in data bank
(referred by accession no.) based on the alignment of amino acid sequences in VD2 and
VD3 regions of ompA gene and variation in length of sequenced portion of ompA gene
owing to gaps in VD2 region. The corresponding nucleotide sequence types (from 1 to 20),
sample identification and farm numbers are also shown for each detected strain. The
portion within the boxes represents the genetically variable domains flanked by the
constant regions of ompA gene. Dots indicate the identical amino acids and hyphens
represent the gaps. Asterisks in the bottom line mark the conserved amino acid residues.
The alignment was done by ClustalX ver. 1.83
![Page 99: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/99.jpg)
Consensus seq. VFCTLGATNGYLKGNSAAFNLVGLFGDT--ATSVAA-TDLPNVSLSQAVVELYTDTAFAWSVGARAALWECGCATLGASF
CS0301 1 ...........................DTQ..QM.QSKN..........I.............................. 80 1 I PG18CS0302 1 ...........................DTQ..QM.QSKN..........I.............................. 80 2 I PG18CS0303 1 ...........................DTQ..QM.QSKN..........I.............................. 80 1 I PG21CS0304 1 ...........................DTQ..QM.QSKN..........I.............................. 80 2 I PG21CS0502 1 .................S.........PTQINN..TAKT..........I.............................. 80 5 III PG5CS0504 1 ...........P.....S.........PTQ.AQ..TTKN..........I.............................. 80 7 III PG6CS0505 1 .................S.........PTQ.AQ..TTKN..........I.............................. 80 8 III PG6CS0507 1 ..............S..S........TKTQ.AQFNTAKIV........................................ 80 10 IV PG7CS0509 1 ...........................DTQ..QM.QSKN..........I..C.....T..................... 80 11 IV PG7CS0510 1 ...........................DTQ..QM.QSKN..........I.............................. 80 1 IV PG7CS0517 1 ...........................PSQLNN..TAKA..S...................................... 80 18 V PG9R27 1 .................S.........PTTVND..TAKT..........I..............K............... 80 Ref. ( accession no. AF269273)Roger130 1 .................S.........PTQVNN..SAKTI.........I.............................. 80 Ref. ( accession no. AF269277)MS04 1 ...........................PTQSSQ..TSKN..........I.............................. 80 Ref. ( accession no. DQ118378)pm39 1 ...........P.....S........TKTQ.SAFD.AKLV........D............................... 80 Ref. ( accession no. AJ004876)Roger132 1 .................S........TKTQ.SAFD.AKLV........................................ 80 Ref. ( accession no. AF269278)
CS0401 1 .................S.........NVD..T.TK-.SI.......S.I.............................. 79 3 II PG1CS0402 1 .................S.........NVD..T.TK-.SI.......S.I.............................. 79 3 II PG2CS0508 1 .................S.........NVD..T.TK-.SI.......S.I.............................. 79 3 IV PG7CS0515 1 ...........................DEN.AQPIG-.S...FA.D.S.I.............................. 79 16 V PG9CS0516 1 ...........................DEN.AQPIG-.S...FA.D.S.I.............................. 79 17 V PG9H7 1 .................S.........NANQST..Q-GSI.......S.I.............................. 79 Ref. ( accession no. AF269276)
R19 1 .................S........--ANE.TA.QA.AV.......S................................ 78 Ref. ( accession no. AF269270) H5 1 .................S........--ANE.TA.QA.AV.......S................................ 78 Ref. ( accession no. AF269275)S45 1 .................S........--ANE.TA.QA.AV.......S................................ 78 Ref. ( accession no. AF269274)32XII 1 .................S........--ANEQNA.GA.AV.....A.S................................ 78 Ref. ( accession no. AY687634)2V 1 ..........................--ATEQTAVLK.LV.......S................................ 78 Ref. ( accession no. AY687633)13VII 1 ..........................--ANDQNTLPE.AV..A..A.S................................ 78 Ref. ( accession no. AY687632)R22 1 ..........................--TNELTAQLN.LV.....A.S................................ 78 Ref. ( accession no. AF269271)
CS0501 1 ..........................L.--T...G.-........N........E......................... 77 4 III PG5CS0503 1 ..........................L.--T...G.-........N........E......................... 77 6 III PG5CS0506 1 ..........................L.--G.....-......N.T.................................. 77 9 III PG6CS0511 1 ..........................LN--VAT.GK-........N.................................. 77 12 IV PG8CS0512 1 ..........................LN--VAT.GK-........N.................................. 77 13 IV PG8CS0513 1 ..........................LN--VAT.GK-........N.................................. 77 14 IV PG8CS0514 1 .......A..................LN--VAT.GK-........N.................................. 77 15 IV PG8CS0518 1 ............R.............L.--T..A..-Q.......A........E......................... 77 19 V PG10CS0519 1 ..........................L.--T.....-Q.......T........E......................... 77 20 V PG10pm220 1 ..........................L.--T...G.-........N........E......................... 77 Ref. ( accession no. AJ005616)pmsh47 1 ..........................L.--T...G.-........N........E......................... 77 Ref. ( accession no. AJ004878)pm197 1 ..........................L.--T...G.-........N........E......................... 77 Ref. ( accession no. AJ004877)PCLH296 1 ..........................L.--T...G.-........N........E......................... 77 Ref. ( accession no. AJ004880)PCLH197 1 ..........................L.--T...G.-........N........E......................... 77 Ref. ( accession no. AJ440241)pmd1340 1 ..............D...........L.--T...G.-........N........E......................... 77 Ref. ( accession no. AJ004879)R24 1 ..........................L.--T.....-Q.......T........E......................... 77 Ref. ( accession no. AF269272)14V 1 ..........................L.--G.....-......N.T.................................. 77 Ref. ( accession no. AY687630)14VII 1 ..........................L.--G.....-......N.T.................................. 77 Ref. ( accession no. AY687631) *******.***..*.**.******** . .. . .*...*.*...**.*.***.*****.***************
Consensus seq. QYAQSKPKVEELNVLCNAAEFTINKPQGYVGQEFPLPETAGTSAATGTKDASIDYHEWQASLALSYRLNMFTP
CS0301 80 ...............................A....DR....D.............................. 153 1 I PG18CS0302 80 ...............................A....DR....D.............................. 153 2 I PG18CS0303 80 ...............................A....DR....D.............................. 153 1 I PG21CS0304 80 ...............................A....DR....D.............................. 153 2 I PG21CS0502 80 ...............................AD...ELK...D.............................. 153 5 III PG5CS0504 80 ..........................K.....A...EF....D.............................. 153 7 III PG6CS0505 80 ..........................K.....A...EF....D.............................. 153 8 III PG6CS0507 80 ..........................K...D.A...DI....E.............................. 153 10 IV PG7CS0509 80 ....................S..........A....DR....D.............................. 153 11 IV PG7CS0510 80 ...............................A....DR....D.............................. 153 1 IV PG7CS0517 80 ...............................A....ELK...D.............................. 153 18 V PG9R27 80 ..........................K...D.A...EI....D.............................. 153 Ref. ( accession no. AF269273)Roger130 80 ...............................V....DIK...T.............................. 153 Ref. ( accession no. AF269277)MS04 80 ...............................K....EI....D.............................. 153 Ref. ( accession no. DQ118378)pm39 80 ..........................K...N.D...DIK...EN.PTG......................... 153 Ref. ( accession no. AJ004876)Roger132 80 ..........................K...N.D...DIK...EN.PTG......................... 153 Ref. ( accession no. AF269278)
CS0401 79 ..........................K...D.V.........DG..NV......................... 152 3 II PG1CS0402 79 ..........................K...D.V.........DG..NV......................... 152 3 II PG2CS0508 79 ..........................K...D.V.........DG..NV......................... 152 3 IV PG7CS0515 79 ...............................A....DLK...T.............................. 152 16 V PG9CS0516 79 ...............................A....DLK...T.............................. 152 17 V PG9H7 79 ...............................K....DL....EK.A........................... 152 Ref. ( accession no. AF269276)
R19 78 ...............................A....DLK...T.............................. 151 Ref. ( accession no. AF269270)H5 78 ...............................A....DLK...T.............................. 151 Ref. ( accession no. AF269275)S45 78 ...............................V....DLK...T.............................. 151 Ref. ( accession no. AF269274)32XII 78 ...............................AD...KLE...E.............................. 151 Ref. ( accession no. AY687634)2V 78 ..........................K...D.A...EI....D.............................. 151 Ref. ( accession no. AY687633)13VII 78 .....................................K.....Q..DV......................... 151 Ref. ( accession no. AY687632)R22 78 ...............................K....EL....DT............................. 151 Ref. ( accession no. AF269271)
CS0501 77 ...................Q...H.......KP....T.....Q..DV......................... 150 4 III PG5CS0503 77 ...................Q..VH.......KP....T.....Q..DV.....................T... 150 6 III PG5CS0506 77 ..............................D.A..........N.ANV......................... 150 9 III PG6CS0511 77 ...................Q............A.....S....N..DV......................... 150 12 IV PG8CS0512 77 ...................Q............A.....S....N..DV......................... 150 13 IV PG8CS0513 77 ...................Q............A.....S....N..DV......................... 150 14 IV PG8CS0514 77 ...................Q............A.....S....N..DV......................... 150 15 IV PG8CS0518 77 ...................Q...H.......KD....Q.....N..DI......................... 150 19 V PG10CS0519 77 ...................Q...H.......KD....Q.....N..DI......................... 150 20 V PG10pm220 77 ...................Q...H.......KP....T.....Q..DV......................... 150 Ref. ( accession no. AJ005616)pmsh47 77 ...................Q...H.......KP....T.....Q..DV......................... 150 Ref. ( accession no. AJ004878)pm197 77 ...................Q...H.......KP....T.....Q..DV......................... 150 Ref. ( accession no. AJ004877)PCLH296 77 ...................Q...H.......KP....T.....Q..DV......................... 150 Ref. ( accession no. AJ004880)PCLH197 77 ...................Q...H.......KP....T.....Q..DV......................... 150 Ref. ( accession no. AJ440241)pmd1340 77 ...................Q...H.......KP....T.....Q..DV......................... 150 Ref. ( accession no. AJ004879)R24 77 ...................Q...H.......KD....Q.....N..DI......................... 150 Ref. ( accession no. AF269272)14V 77 ..............................D.A..........N.ANV......................... 150 Ref. ( accession no. AY687630)14VII 77 ..............................D.A..........N.ANV......................... 150 Ref. ( accession no. AY687631) *******************..*..**.***. *** .*** *. *********************.***
Clusters Strains Variable domain 2 Seq. types Farm no. Sample ID
A
B
C
D
Clusters Strains Variable domain 3 Seq. types Farm no. Sample ID
A
B
C
D
![Page 100: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/100.jpg)
pm39 (AJ004876)
0.05 units
Roger132 (AF269278)
CS0507 (IV; PG7)
CS0401 (II; PG1)CS0402 (II; PG2)CS0508 (IV; PG7)
H7 (AF269276)
14V (AY687630)
14VII (AY687631)
CS0506 (III; PG6)CS0511 (IV: PG8)CS0514 (IV; PG8)CS0513 (IV; PG8)
CS0512 (IV; PG8)
pm220 (AJ005616)
CS0503 (III; PG5)
PCLH197 (AJ440241)
PCLH296 (AJ004880)
pm197 (AJ004877)
CS0501 (III; PG5)
pmd1340 (AJ004879)
pmsh47 (AJ004878)
R24 (AF269272)
CS0518 (V; PG10)CS0519 (V; PG10)
2V (AY687633)
R22 (AF269271)
13VII (AY687632)
H5 (AF269275)
R19 (AF269270)
S45 (AF269274)
32XII (AY687634)
CS0515 (V; PG9)CS0516 (V; PG9)
CS0504 (III; PG6)CS0505 (III; PG6)
R27 (AF269273)
CS0502 (III; PG5)CS0517 (V; PG9)
Roger130 (AF269277)
MS04 (DQ118378)
CS0510 (IV; PG7)
CS0302 (I; PG18)CS0304 (I; PG21)
CS0509 (IV; PG7)CS0303 (I; PG21)CS0301 (I; PG18)
C. trachomatis-LGV (L35605)
C. trachomatis-serovar-D (X62920)
C. trachomatis-serovar-C (AF352789)
C. muridarum-MoPn (X63409)
C. psittaci-MN Zhang (AF269281)
Human lymphogranuloma Worldwide
Human genital infection Worldwide
Mouse pneumonitis USA
Avian chlamydiosis Worldwide
Conjunctivitis Japan
Human eye infection Worldwide
Conjunctivitis Japan
Conjunctivitis Japan
Conjunctivitis JapanConjunctivitis Japan
Conjunctivitis Japan
Conjunctivitis Italy
Normal (jejunum) USA
Conjunctivitis JapanConjunctivitis JapanEnteritis (colon) USA
Conjunctivitis JapanConjunctivitis Japan
Conjunctivitis JapanConjunctivitis Japan
Normal (colon) Germany
Normal (intestine) USA
Enteritis (feces) USA
Conjunctivitis USA
Normal (colon) Germany
Conjunctivitis USA
Normal (colon) Germany
Conjunctivitis Japan
Conjunctivitis JapanResp. dis. (nasal mucosa) USA
Conjunctivitis Japan
Conjunctivitis JapanConjunctivitis JapanConjunctivitis JapanConjunctivitis JapanConjunctivitis JapanConjunctivitis Japan
Conjunctivitis JapanConjunctivitis JapanConjunctivitis Japan
Conjunctivitis Japan
Normal (colon) Germany
Normal (colon) Germany
Conjunctivitis USA
Normal (ilieum) USA
Disease/Source Geographical location
Bronchopneumonia Germany
Bronchopneumonia Germany
Bronchopneumonia Germany
Bronchopneumonia Germany
Bronchopneumonia Germany
Bronchopneumonia Germany
Bronchopneumonia Germany
Clusters
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
A
B
B
B
B
B
B
C
C
C
C
C
C
C
D
D
D
D
D
D
D
D
D
D
D
D
D
D
D
D
D
D
96.4%
99.9%
93.6%
100%
99.9%
90.2%
96.8%
100%
100%
90%
99.4%
100%
99.8%
100%
100%
100%
96%
100%
96.6%
Fig. 18. Neighbor-joining (NJ) phylogenetic tree, based on nucleotide sequences of VD2 and VD3 regions
of the ompA gene of different strains of C. suis and other Chlamydia spp. The strains detected in this study
are shown in bold letters along with farm and sample identity in parentheses. The corresponding genetic
clusters from A to D, isolation source/disease condition and geographical locations are shown against each
strain. The genetic distance is indicated in 0.05 unit bar. Bootstrap values are shown at respective nodes.
The C. psittaci is used as out-group and branch length is reduced to half.
![Page 101: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/101.jpg)
96
suis among commercial piggeries. PCR based diagnosis is convenient and fast as isolation
of C. suis is considered as difficult due to antibiotic treatments or feed supplementations
(82, 178).
The 16S-23S rRNA intergenic spacer region and ompA are subjected to constant
systematic selective pressure and functional conservations and are ideal targets for
phylogenetic studies (20, 41). The genetic analysis of 16S-23S rRNA intergenic spacer
region and partial ompA gene revealed high genetic variations among C. suis strains. The
genetic variations in 16S-23S rRNA intergenic spacer region were less as compared to the
ompA gene. All the 9 variant 16S-23S rRNA intergenic spacer sequence types showed less
than 3% differences, whereas 20 ompA gene sequence variants detected from conjunctivitis
cases showed 22% genetic variation. The difference in the genetic variations between
ompA and 16S-23S rRNA intergenic spacer region may be due to the difference in
selective pressure at both loci associated with biphasic developmental cycle of chlamydiae
(20). In this study all the genetically variable strains of C. suis were detected from the
conjunctivitis cases but strains detected from gut and lung specimens are also reported to
have high degree of genetic variations (82).
Findings of this study are contradictory as compared to those of other chlamydiae
causing eye infections in animals, like feline conjunctivitis by C. felis (26) and inclusion
body conjunctivitis in guinea pigs by C. caviae (135). All the known strains of C. felis and
C. caviae have relatively conserved ompA loci (173, 227). However our findings correlate
with the situation in the human C. trachomatis strains, which have divergent ompA loci but
relatively conserved other portion of genome (20, 98, 189). Immunological selection might
promote such a process as change of MOMP peptide sequence, which might help the
chlamydiae to escape immune response.
![Page 102: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/102.jpg)
97
According to the ompA gene composition, all genetically diverse strains were
divided into 4 groups. But the ompA gene based clusters of variant C. suis strains did not
show specific tissue tropism and disease association. These results are in accordance with
other studies suggesting no phylogenetic relationship among serovars that corresponds to
various pathobiotypes of C. trachomatis (20, 189). The C. suis strains of ophthalmic and
non-ophthalmic origin could not be differentiate neither in ompA gene nor 16S-23S rRNA
intergenic spacer region based phylogenetic analysis. Although serotypic variation has not
yet been studied in C. suis, genetic and biological variations have been reported among C.
suis strains (82, 95, 99, 183). The pathobiological significance of this high genetic
diversity is still not known.
Interestingly multiple genotypes of C. suis were involved in either individual
animal or a farm. The detection of multiple genotypes in ophthalmic swabs may also
indicate the repeated infection. Previous observations have also suggest that the severe
clinical symptoms and lesions seen in human trachoma are the results of repeated C.
trachomatis infection and are immunologically mediated (65, 130, 195). C. suis causes
mucopurulent keratitis/conjunctivitis under field conditions as observed in the present and
previous reports (165). However, the controlled experimental infection of gnotobiotic pigs
with H7 strain of C. suis (an eye isolate) was observed to be less severe than those of field
cases (163). It may be due to the use of single strain or no repetition of inoculations.
Besides the repetitive infection, other factors may be playing supportive role in disease
precipitation viz. poorly ventilated and dusty housing, houseflies (Musca domestica) and
other microbes like Mycoplasma hyorhinis, Klebsiella pneumoniae and Pasteurella sp.
(165).
In this study, mixed infection of C. suis along with other chlamydiae could not be
detect. It may be due to lack of sample diversity from non-ophthalmic origin. However, it
![Page 103: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/103.jpg)
98
also suggests that ophthalmic infection is exclusively caused by C. suis. Although C. suis
has been isolated from porcine ocular samples in America and Italy only, there is no report
regarding role of chlamydiae in porcine conjunctivitis and keratoconjunctivitis in Japan or
any other Asian country. Further experimental studies are required to access the
pathogenicity of various C. suis strains and to understand biological significance of high
genetic diversity.
SUMMARY
Commercial piggeries with frequent ocular and reproductive problems were
etiologically investigated. Samples from 49 animals were collected from 5-pig farms
located in three prefectures of Japan from 2003 to 2005. Samples were screened
preliminarily with FAT and then followed by nested PCR tests. Chlamydia suis were
detected among 44.9% (22 out of 49) samples in all 5 farms by 16S-23S rRNA intergenic
spacer region based PCR and Chlamydia genus-specific PCR targeting ompA gene.
Whereas, all the samples were found negative by ompA gene based Chlamydophila genus
specific PCR. All the PCR positive samples were accrued from conjunctivitis cases only.
Total 9 C. suis strains with less than 3% nucleotide variation were detected by nucleotide
sequence analysis of 16S-23S rRNA intergenic spacer region, whereas, 20 C. suis strains
with up to 22% nucleotide variation were detected by analyzing ompA gene in VD2 and
VD3 regions. Multiple genotypes (up to 4 types) were found infecting either individual
animals or farms. This study revealed high prevalence of C. suis in porcine chlamydiosis
and association of genetically diverse, multiple genotypes in ophthalmic infection.
![Page 104: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/104.jpg)
99
Molecular characterization of the Chlamydophila caviae strain OK135,
isolated from human genital tract infection, by analysis of some structural and
functional genes
INTRODUCTION
The chlamydiae cause a variety of diseases among human beings and animals (185,
188). Genital chlamydial infections are highly prevalent among adults and adolescents in
developing and developed countries (1, 89, 92, 204). Mostly Chlamydia trachomatis
(serovar D to K and L1-L3) and rarely Chlamydophila abortus are implicated in human
genital tract infections, manifested as salpingitis, cervicitis, pelvic inflammatory disease
(PID) and abortions.
Chlamydophila caviae, previously known as a guinea pig inclusion conjunctivitis
(GPIC) strain of Chlamydia psittaci, has been classified as a separate species under family
Chlamydiaceae based upon the 16S rRNA gene homology (43). C. caviae is a host specific
pathogen of guinea pigs and causes either self-limiting or asymptomatic inclusion
conjunctivitis among young (4-8 weeks old) guinea pigs (63, 101, 135). C. caviae and
guinea pig are important small animal experimental models to simulate the antigenic and
immune response of human chlamydial infections (118, 150-152). While C. caviae has no
previous history of infecting human beings, very recently, DNA of C. caviae was detected
in human, cat, rabbit eyes (114), and also in waste water samples (110), indicating the
possible wide ecobiological niche of C. caviae. Whole genome sequence of C. caviae
revealed many species-specific genes (153), although all the known 6 strains of C. caviae
CHAPTER-V
![Page 105: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/105.jpg)
100
isolated from guinea pigs in different continents in different years were found to have
identical ompA gene sequences (227). In this chapter, characterization of a rare strain of C.
caviae, (OK135) was done, which was isolated from a woman with cervicitis by
Mastumoto et al. (unpublished work). Based on phylogenetic analysis of 16S rRNA, ompA
and groEL-1 genes, the OK135 strain was found to be genetically closely related to other
strains of C. caviae. This study highlights the ability of genetically diverse and non-
conventional chlamydiae to cause human genital tract infections and their probable escape
from detection due to use of diagnostic tests specific for conventional human chlamydial
species.
MATERIALS AND METHODS
Case history: OK135 strain was isolated from a 20 years old female suffering
from severe cervicitis (Matsumoto et al., manuscript in preparation). The strain was
isolated and maintained subsequently in McCoy cell line. Preliminary examination of
strain was done by Giemsa and iodine staining and also by using chlamydial group specific
Mab in direct immunofluorescence test (Chlamydia FA, Denka Seiken Co. Ltd, Tokyo,
Japan). The results of iodine staining and C. trachomatis specific direct
immunofluorescence staining with Mab (MicroTrak; SYVA Co., Palo Alto, California,
USA) showed that OK135 strain is a non-conventional type of chlamydial species (122).
DNA extraction: SepaGene DNA extraction Kit (Sanko Junyaku, Tokyo, Japan)
was used to extract DNA according to the instructions of manufacturer. After removing
cell debris by centrifugation at 1,000 ! g, partially purified elementary bodies were used
for DNA extraction. DNA was finally dissolved in 50 µl Tris-EDTA (TE) buffer pH 7.4
(100 mM Tris-HCl, pH 7.4 and 10 mM EDTA, pH 8.0) and stored at –30°C until used.
![Page 106: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/106.jpg)
101
PCR amplification of 16S rRNA, ompA and groEL-1 genes: Overlapping DNA
fragments of 16S rRNA (1445 bp), ompA gene (1148 bp) and groEL-1 gene (1560 bp)
were amplified by single step PCR using pairs of primers as shown in Table 20. The 50 µl
PCR reaction mixture contained 0.20 µM of each forward and reverse primer, 250 µM of
each dATP, dTTP, dGTP, dCTP, 100 µM of Mg2+
in buffer and 2.5 units of TaKaRa Ex-
Taq (TaKaRa Bio Inc., Otsu, Japan) and 2.0 to 3.0 µg of template DNA. Thermocycling
conditions were adjusted according to primer sets and in all, 30 amplification cycles were
performed.
Cloning and sequencing of DNA fragments: The PCR amplified DNA fragments
of each gene were purified by QIAquick Gel Extraction kit (Qiagen, Hilden, Germany).
Then each DNA fragment was cloned in the pT7 blue vector (Novagen, Madison,
Wisconsin) by transforming E. coli DH10" strain by electroporation using Gene Pulser
cuvettes, 0.5 cm electrode gap (Bio Rad, Hercules, California). Clones containing DNA
insert were selected as in CHAPTER I (171). Total 3 to 5 clones with an expected size
DNA fragment insert were selected by using Premix Colony Direct PCR insert check kit
(Tyobo Co., Osaka, Japan) and taken for sequencing. Each DNA fragment was sequenced
by using thermo sequenase cycle sequencing Kit (USB Corporation, USA) using forward
(T7) and reverse (M13) universal fluorescent labeled primers using SEQ4!4 personal
sequencing system (Amersham Pharmacia Biotech).
Analysis of sequences and construction of phylogenetic trees: The obtained
sequences were assembled and edited using Genetyx-Mac/ATSQ 4.2.3 and Genetyx-Mac,
version 13.0.6 (SDC, Tokyo, Japan). For phylogenetic analysis, representative gene
sequences of 16S rRNA, ompA and groEL-1 genes of chlamydial species and other
bacteria associated with reproductive tract infections of animals and human were retrieved
from the DDBJ. Using ClustalX, version 1.83 (198), done the multiple alignments of the
![Page 107: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/107.jpg)
102
Table 20. Primers used to amplify16S rRNA, ompA and groEL-1 genes.
Name Sequence Positionsa
Tm(°C)b
Amplicon
16S rRNA gene
CPR/P1F 5’ CTGAGAATTTGATCTTGGTTCAG 3’ 5-27 54-56 400 bp
CPR/P1R 5’ CGCTTCGTCAGACTTTCGTCCATT 3’ 404- 381 60
CPR/P2F 5’ CGTCTAGGCGGATTGAGAGATTG 3’ 291-313 60-62 418 bp
CPR/P2R 5’ CGCATTTCACCGCTACACGTGGAAT 3’ 708-684 60-62
CPR/P3F 5’ GCGTGTAGGCGGAAAGGAAAGTT 3’ 585-607 60-62 413 bp
CPR/P3R 5’ CCAGGTAAGGTTCTTCGCGTTGCAT 3’ 997-973 59-61
CPR/P4F 5’ CCGTGTCGTAGCTAACGCGTTAAGT 3’ 860-884 60-62 444 bp
CPR/P4R 5’ GGCTAGCTTTGAGGATTTGCTCCAT 3’ 1403-1279 59-61
CPR/P5F 5’ CGAGGATGACGTCAAGTCAGCAT 3’ 1191-1213 60-62 367 bp
CPR/P5R 5’ TGTCGACAA AGGAGGTGATCCAG 3’ 1557 –1537 55-57
ompA gene
M/0PF 5’ GCAAGTATAAGGAGTTATTGCTTG 3’ -275 to -252 54-56 352 bp
M/0PR 5’ CCTACAGGCAAGGCTTGTAAG 3’ 56-77 57-60
M/1PF 5’ CGGCATTATTGTTTGCCGCTAC 3’ 20-41 59 390 bp
M/1PR 5’ CGAAGCGATCCCAAATGTTTAAGGC 3’ 409-385 59-61
M/2PF 5’ CGCTTACGGAAGGCATATGCAAGATG 3’330-355 62 397 bp
M/2PR 5’ GTGAATCACAAATTGTGCTGGGCT 3’ 726-703 58-60
M/3PF 5’ CGTGGAGCTTTATGGGAATGTGGTTG 3’ 607-632 62 330 bp
M/3PR 5’ GAGCAATGCGGATAGTATCAGCATC 3’ 937-913 60-62
M/4PF 5’ GGCGTAAACTGGTCAAGAGCAAC 3’ 886-908 60-62 387 bp
M/4PR 5’ TCCCAGGTTCTGATAGCGGGACAA 1272-1246 61-63
groEL-1 gene
CVG/1PF 5’ GGCAGTTCTC AAGTAAGAGA AATC 3’ -66 to -43 56-58 392 bp
CVG/1PR 5’ GCAGTTACGTTTCTCAATCCTTC 3’ 326-304 55-58
CVG/2PF 5’ GCAGATAAAGCTGGTGATGGAAC 3’ 244-266 58-60 380 bp
CVG/2PR 5’ GGATTTGTAGAGAAGTAGCTGGAT 3’ 623-600 56-58
CVG/3PF 5’ CGAAACTGTCCTCGACGTTGT 3’ 549-569 57-60 405 bp
CVG/3PR 5’ CCTAACATAGCTAGAGTTGTGTTC 3’ 953-930 56-58
CVG/4PF 5’ GGTCAACTCATCAGCGAAGAG 3’ 892-912 57-60 436 bp
CVG/4PR 5’ GTGCTCCGATTTGCTCATCTTC 3’ 1306-1327 59
CVG/5PF 5’ CGCTGCATCCCTACTTTAGAAG 3’ 1261-1282 59 443 bp
CVG/5PF 5’ CCCTTTCTTCTCAAGATGGATG 3’ 1703-1682 57-59
a Based on 16S rRNA gene of Chlamydophila psittaci-Prk/GCP-1 strain (D85713), ompA gene of
C. psittaci-6BC strain (accession no. X56980) and groEL-1 gene of Chlamydophila caviae-GPIC
strain (accession no. AE015925). The negative values indicate the nucleotide positions upstream of
respective open reading frame. b Averages of melting temperatures of forward and reverse primer sets were used in the direct PCR
amplifications.
sequences. Phylogenetic analysis was done with programs available in the PHYLIP
(version 3.6a3; [http://evolution.genetics.washington.edu/phylip.html]). The distance
matrix between species was computed by DNADIST using Jukes-Cantor model (93) and
![Page 108: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/108.jpg)
103
clustering was done using NJ method (170). The bootstrap values were calculated from a
consensus tree constructed by generating 1,000 random data sets using SEQBOOT (45). In
case of 16S rRNA gene, Parachlamydia acanthamoeba was taken as outgroup.
Extraction of chlamydial outer membrane complexes (COMC): Extraction of
chlamydial outer membrane complexes (COMC) was done as reported earlier by using 2%
sodium N-lauroyl sarcosine (Sarkosyl; Sigma) (27). The protein concentrations of the
extracts were determined by Bio-Rad protein assays Kit (Bio-Rad, CA). The proteins
profile of extracted COMC was visualized on sodium dodecyl sulfate polyacrilamide gel
electrophoresis (SDS-PAGE) (108).
RESULTS
The nucleotide sequences and resultant amino acid sequences of 16S rRNA, ompA
and groEL-1 genes were compared with sequences in the data bank by NCBI-BLAST
search (http://www.ncbi.nlm.nih.gov). The comparative phylogenetic analysis of 3
sequenced genes with previously reported chlamydial species is as follows:
16S rRNA gene: The 16S rRNA gene of OK135 strain was 100% homologous to
the C. caviae GPIC strain (accession no. AE015925), which was used by the Institute of
Genomic Reseach (TIGR) for whole genome sequencing. OK135 strain was also closely
related to another C. caviae GPIC strain (accession no. D85708 and ATCC No. VR-813,
isolated by E.S. Murray in 1964 from the conjunctiva of guinea pigs with conjunctivitis in
Massachusetts, USA), showing 99.7% (1509/1514) nucleotide homology (Fig. 19). The NJ
analysis of 16S rRNA gene also confirmed that the sequence of OK135 strain is identical
to that of C. caviae GPIC strain (accession no. AE015925). All the 3 strains of C. caviae
form a genetically distinct branch diversing from other Chamydophila spp. and Chlamydia
![Page 109: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/109.jpg)
C. trachomatis- C/TW-3/OT (D85720)
C. trachomatis- L2/434/BU (U68443 )
C. trachomatis- D/UW-3/CX (AE001347)
C. trachomatis- E/UW-5/Cx (D85722)
C. suis- S45 (U73110)
C. muridarum- MoPn (AE002279)
C. pecorum- Koala type II (D85717)
C. pneumoniae- CWL029 (AE001668)
C. abortus- Ov/B577 (D85709)
C. psittaci- 6BC (U68447)
C. felis- Fe/145 (D85702)
C. caviae- GPIC (D85708)
C. caviae- GPIC (TIGR) (AE016997)
Parachlamydia acanthamoebae- Bn9 (Y07556)
C. psittaci- Prk/Daruma (U68447)
C. abortus- EBA (U76710)
99.4%
64.9%
100%
99.7%
51.7%55.3%
100%
94%
100%
83%
96.2%Bovine Abortion USA
Parrot Systemic infection Japan/India
Sheep Abortion USA
Parakeet Systemic infection USA
Guinea pig Conjunctivitis USA
Guinea pig Conjunctivitis USA
Cat Conjuctivitis USA
Koala Urogenital infection Australia
Human Pneumonitis Taiwan
Human Cervicitis USA
Human Trachoma Taiwan
Human Cervicitis USA
Human Lymphogranuloma USA
Pig Asymptomatic Austria
Mouse Pneumonitis USA
Acanthamoeba castellanii Germany
Human Cervicitis JapanC. caviae- OK135
0.05 units Species Disease conditions Location
Fig. 19. The NJ phylogenetic tree of the nucleotide sequence of 16S rRNA gene of the OK135 strain as compared to other chlamydialstrains of Chlamydiaceae family. The P. acanthamoebae was taken as out-group and its branch is shortened to half. The genetic dista--nce is shown as unit bar.
![Page 110: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/110.jpg)
105
spp. This is supported by significantly high bootstrap value (Fig. 19).
ompA gene: The genetic composition of ompA gene, which has 4 genetically hyper
variable domains (VDs), was found to be identical in OK 135 and GPIC (TIGR) strains.
However, when compared to another strain-GPIC (sequence accession no. AF269282 and
isolate ATCC No. VR-813), 2 nucleotide differences were found. One at position 843 of
ORF (T base changed to C) with no change in amino acid residue and another at position
996 in VD4 (A base changed to T) with conversion of lysine residue to asparagines.
Interestingly, in another ompA gene sequence of C. caviae available in literature (226),
only single nucleotide polymorphism (SNP) at position 843 was observed. We also
sequenced promoter region of ompA gene up to 178 nucleotides upstream and found this
region to be conserved among all C. caviae strains. The NJ tree of ompA gene (without out
group) of all the nine species in Chlamydiaceae and all C. caviae strains, also provided
100% reliability support for the formation of distinct clade of C. caviae strains within the
family Chlamydiaceae (Fig. 20-A). The COMC composition of OK135 strain in SDS-
PAGE showed protein bands of MOMP and other proteins with identical sizes to the GPIC
(TIGR) strain.
groEL-1 gene: The GroEL-1 chaperonin of OK135 strain was 100% homologous
to other strains of C. caviae but the interspatial differences were observed. In the unrooted
NJ tree without out-group, the groEL-1 gene of other microbes commonly associated with
sexually transmitted diseases and members of order Chlamydials was found to be
phylogenetically distant (Fig. 20-B). The analysis of functional domains of this GroEL-1
chaperonin protein coded by this groEL-1 gene showed that all the functionally important
sites are conserved in family Chlamydiacae including this new OK135 strain (Table 21).
![Page 111: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/111.jpg)
0.05 units
Neisseriae gonorrhoea(NG2095)
Parachlamydia acanthamoebae-
UWE25 (pc1180)
100%
C. pneumoniae-
C. trachomatis- serovar D (AJ783840) C. muridarum- MoPn
C. caviae- GPIC (AE015925)
(CTU52049)
M69217TWAR
100%100%
100%
Treponema pallidum (TP0030)
Streptococcus agalactiae (SAG2074)
Mycoplasma genitalium(MG392)
91.9%
99.8%
C. caviae-OK135
99.9%
(A)
(B)
0.05 units
C. muridarum- SFPD (U68437)
C. suis- PCLH197 (AJ440241)
C. trachomatis- c/TW3/OT (AF352789)
C. felis- Baker (AF269257)
C. psittaci- 6BC (X56980)
C. abortus- EBA (AF269256)
C. pecorum- LW613 (AJ440240)
C. pneumoniae- IOL-204 (M64064)
C. caviae- GPIC (AF269282)C. caviae- GPIC (TIGR) (AE015925)
C. caviae- OK135
C. caviae- GPIC (Ref)
100%
99.6%
95.4%
100%
Fig. 20-B. The NJ tree showing the phylogenetic distance in groEL-1 gene of OK135 strain (bold letters) vis-à-vis other C. caviae strains, chlamydial species and bacteria frequently in--volved in sexually transmitted infections.
Fig. 20-A. The NJ phylogenetic tree of the nucleotide sequence of the ompA gene of OK135strain (bold letters) and all 9 species of family Chlamydiaceae including all reported strainsof C. caviae.
![Page 112: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/112.jpg)
Table 21. Multiple alignment of functional regions of GroEL-1 of OK135 strain vis-à-vis other chlamydial species and bacteria associated with reproductive diseases. The residues important for
polypeptide binding are boxed in solid line, for GroES contact in dashed line box and for ATPase activity in doted line box.
Amino acid residue positionsa
Organisms 87 88 89 90 91 150 151 152 199 201 203 204 234 237 259 263 264 265 361 383 405 406
Chlamydia trachomatis Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Chlamydia muridarum Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Chlamydophila pneumoniae Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Chlamydophila caviae-OK135 Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Chlamydophila caviae Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Chlamydophila abortus Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Chlamydophila abortus Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Chlamydophila felis Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Chlamydophila pecorum Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Parachlamydia acanthamoeba Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Ile Leu Leu Val Val Asp Asp Ala Ala Ala
E. coli Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Neisseriae gonorrhoea Asp Gly Thr Thr Thr Ile Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
Streptococcus agalactiae Asp Gly Thr Thr Thr Valb Ser Ser Tyr Ser Tyr Met Leu Leu Leu Val Leu Asp Asp Ala Ala Ala
Mycoplasma genitalium Asp Gly Thr Thr Thr Ile Ser Ser Tyr Ser Tyr Met Leu Leu Val Ala Val Asp Asp Gly Ala Ala
Treponema pallidum Asp Gly Thr Thr Thr Val Ser Ala Tyr Ser Tyr Phe Leu Leu Leu Val Val Asp Asp Ala Ala Ala
a The numbering of the amino acid residue positions is based on the E. coli GroEL-1.
b The substituted amino acid residue as compared to E. coli are shown in bold.
![Page 113: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/113.jpg)
108
DISCUSSION
Chlamydiae have been reported in a variety of disease syndromes in human beings
and animals (185, 188). Among the Chlamydiales, C. trachomatis and C. pneumoniae are
established to be human pathogens. However, other Chlamydophila species can
occasionally infect human beings (113). In this chapter, a C. caviae strain, OK135, isolated
from a clinical human cervicitis case was identified and genetically characterized. C.
caviae usually cause self-limiting or asymptomatic ophthalmic infection in its natural host,
guinea pigs (63, 101, 135). Infection in human is unknown except a very recent report of
C. caviae DNA detection in human eye samples (114). The chlamydial cervicitis is usually
caused by C. trachomatis, serovars D to K, however, serovar E is reported to be common
(190).
Initially, 16S rRNA gene was analyzed for the phylogenetic identification of
OK135 strain as this gene formed the basis of recent classification of all the chlamydiae
(43). The 16S rRNA gene is reported to have species-specific conserved motifs in the order
Chlamydials. (43, 54, 149). OK135 strain was found to be genetically identical to GPIC
strain. Furthermore, the structural analysis of MOMP, which constitute majority of
chlamydial envelope and responsible for serological variations, was done (10, 50, 186,
187). Also genetic makeup of groEL-1 gene which encodes GroEL-1 (HSP 60) was
analyzed as these types of protein are recognized by the host Toll-like receptors (TLRs) as
part of innate defense system and implicated in diseases pathogenesis (23, 103).
The ompA gene locus of OK135 strain was identical to GPIC strain, and 1 to 2 SNP
were detected as compared to two other C. caviae sequences available in the data bank.
However, in other report, no allelic polymorphism was observed among 6 C. caviae strains
in partially sequenced (70%) ompA locus (227). All the 6 strains were identical to ompA
![Page 114: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/114.jpg)
109
gene sequence of GPIC strain reported by Zhang et al. (226), which had a SNP at 843
position between VD3 and VD4 of ompA gene as compared to OK135 strain. Therefore,
all the C. caviae strains have relatively conserved ompA locus as compared to other
Chlamydia spp. and Chlamydophila spp., which show high polyporphism in ompA gene
(98, 189). Lack of high genetic variation among C. caviae strains as compared to other
chlamydiae with polymorphic ompA gene may be due to differences in host-pathogen
interaction and selective pressure exerted by host immune response. Furthermore, it has
also been observed that anti-MOMP serological response in C. caviae is not so protective
in experimental ophthalmic and genital experimental infections (13, 203). This is similar to
the non-prominent anti-MOMP immune response shown by C. pnemoniae that also lack
polymorphism in ompA gene locus (28). The C. pneumoniae infection are widely prevalent
among human population (106). Although the C caviae GPIC has been studied extensively
as surrogate experimental strain to understand pathogenesis and immune responses in
human genital infections (150, 215), the C. caviae infection among human are uncommon
or rather unknown. In the present case, while the circumstantial evidences of contacting C.
caviae by the said patient from primary host (guinea pig) are lacking, the possible reason
for switching of host species may be due to lack of protective immunity in advance or
cross protection among human to C. caviae infection. Another possible source of infection
may be still unknown host or carrier of C. caviae as the recent reports are also indicating
possible wider ecobiological niche (110, 114).
It was also observed that functional sites in GroEL-1 protein (HPS 60) coded by
groEL-1 gene are conserved among all the members of Chlamydiaceae family, it can be
speculated that chlamydiae may exhibit a similar disease pathogenesis or ability to infect
multiple host species. Therefore, diagnosis of aberrant chlamydial species in various
clinical manifestations is important. These types of infection may exist in human
![Page 115: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/115.jpg)
110
population but remained undiagnosed due to use of species specific diagnostic methods in
chlamydial reproductive tract infections viz. PCR or LCR Kit are mostly targeted at 7.5-kb
plasmid or C. trachomatis specific monoclonal antibody based fluorescent tests and in such
cases the clinical diagnosis of C. caviae can be bypassed (121). It is also observed that
severity of clinical manifestation and inflammation of urogenital chlamydia infections is
strongly influenced by the number of chlamydiae present in the genital tract rather than the
infecting serovar of C. trachomatis (61). Hence, undiagnosed infection with such rare
chlamydial species can proliferate in genital tract can lead to pelvic inflammatory disease
(PID) and its subsequent complications like salpingitis and tubal factor infertility, similar
to those occurred by other genital chlamydial species. This study also suggests need for
development of new diagnostic tools for chlamydial reproductive infections, encompassing
broader Chlamydiaceae group.
SUMMARY
Genital tract infections by different serovars of C. trachomatis are reported to be
alarmingly higher in recent studies. Occasionally C. abortus also causes human
reproductive disorders. The C. caviae is a highly host specific species and causes
conjunctivitis and other eye infections in guinea pigs. In our study, we characterize a C.
caviae strain (OK135) isolated from a woman with acute cervicitis, by sequencing 16S
rRNA, ompA and groEL-1 genes. The isolate was consequently confirmed as C. caviae and
phylogenetically closely related to other strains of C. caviae. The ompA gene had 100%
homology to GPIC strain of C. caviae used for genome project by TIGR, but has 1 to 2
nucleotide substitution in the coding region as compared to other already reported C.
caviae strains. The COMC extracted by sarkosyl detergent showed 38.5 kDa size of
![Page 116: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/116.jpg)
111
MOMP along with other proteins, similar to those of GPIC strain. The groEL-1 and 16S
rRNA genes also showed 100% homologous to those of GPIC strains. Therefore, the
OK135 strain of C. caviae appears to be closely related to GPIC strain. This report
highlights the ability of non-conventional chlamydiae to cause human infections without
many genetic and subsequent structural and physiological adjustments. It suggests the need
for broader and not species-specific diagnostic approach for human chlamydial infections.
![Page 117: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/117.jpg)
112
Chlamydiae are the obligate intracellular bacterial pathogens of animals and human
beings. They are responsible for a diverse range of diseases in birds and mammals
including humans. C. trachomatis and C. pneumoniae are established to be human
pathogens. Animal chlamydial infections are caused by C. psittaci, C. abortus, C. suis, C.
muridarum, C. pecorum, C. felis and C. caviae. Various studies have shown natural
prevalence of genetically diverse strains of chlamydiae within each species. C. psittaci is
mainly prevalent among avian species and causes either inapparent or clinical infection of
varying severity. C. psittaci is also considered to be potentially pathogenic to in-contact
mammalian hosts including human beings.
This thesis describes the molecular epidemiology, genetic diversity and virulence of
C. psittaci strains, which were naturally distributed among diverse types of avian fauna, in
order to compare the risk to the health of avian and mammalian fauna as well as human
beings. This study was also intended to detect the chlamydiae in some diseased animals
and humans, as different chlamydial species were detected recently from previously known
disease syndromes.
In the molecular epidemiological study to investigate the diversity and natural
distribution of C. psittaci, total 1,147 samples from 11 avian orders including 53 genera
and 113 species of feral and captive birds were examined using ompA gene based nested
PCR. Three types of chlamydiae including C. psittaci (94.12%), C. abortus (4.41%) and
unknown Chlamydophila sp. (1.47%) were identified among 68 birds, which includes 59
from Psittaciformes, 8 from Ciconiiformes and 1 from Passeriformes orders. Based on
nucleotide sequence variations in the VD2 region of ompA gene, all 64 detected C. psittaci
strains were grouped into 4 genetic clusters. Clusters I, II, III and IV were detected from
CONCLUSION
![Page 118: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/118.jpg)
113
57.35%, 19.12%, 10.29% and 7.35% samples, respectively. A single strain of unknown
Chlamydophila sp. was found to be phylogenetically intermediate between Chlamydophila
species of avian and mammalian origins. Therefore, it was concluded that, though various
genetically diverse chlamydiae may have caused avian chlamydiosis, only a few C. psittaci
strains were highly prevalent and frequently associated with clinical/subclinical infections.
All the 46 known and genetically diverse strains of C. psittaci, detected in the
present and previous studies from various avian and mammalian hosts including human
beings were genetically analyzed to evaluate the phylogenetic relationships, pathobiotic
implications and to improve the strain categorization. The ompA gene loci of 11 new C.
psittaci strains along with previously known 35 strains were analyzed. 16S rRNA gene of
two highly diverse strains CPX0308 and Daruma was also studied. On the basis of the
conserved region of ompA gene, 4 lineages of C. psittaci strains with genetic distance of
less than 0.1 (dissimilarity less than 10%) were noted. The C. psittaci strains of 4 lineages,
with genetic distance of less than 0.05 (dissimilarity less than 5%) were subdivided into 8
genetic clusters. The ompA gene loci of C. psittaci strains of lineage-1 were relatively
conserved and these strains were frequently involved in infection of human (psittacosis)
and other mammalian species. Lineage-2 strains are genetically diverse and divided into 5
genetic clusters. Lineage-3 and 4 represented by WC and CPX0308 strains, respectively,
are genetically more close to Chlamydophila spp. causing infection among mammalian
hosts. The proposed scheme classifies diverse C. psittaci strains according to the genetic
variations and phylogenetic relationships. It may also be useful to classify even uncultured
C. psittaci strains detected in clinical diagnosis.
Further to evaluate the degree of virulence of C. psittaci strains predominantly
responsible for avian chlamydiosis and human psittacosis, BALB/c mice were used as
experimental infection model. Four representative C. psittaci strains: No!e, MN, Mat116
![Page 119: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/119.jpg)
114
and Borg were intranasally inoculated at dose rate of 0.5 IFU, 5 IFU, 50 IFU, 5!102 IFU,
5!103 IFU and 5!10
4 IFU per gram body weight. The LD50 of Nosé, MN, Mat116 and
Borg strains were 3.1!103, 19!10
3, 12!10
3 and 6.3!10
3 IFU/gm body weight, respectively.
The intensity of clinical signs against the infectious doses of 5!103 and 5!10
4 IFU/gm
body weight was the same among the 4 strains, however, at 50 and 5!102 IFU/gm body
weight doses, the MN strain showed milder clinical signs. The animals incubated with the
MN strain at higher doses showed less variation in the relative body weights as compared
to those inoculated with the Nosé, Mat116 and Borg strains. Among the 4 strains, complete
recovery and clearance of chlamydial infection was verified at 21 days post infection, as no
chlamydial DNA and/or chlamydial IFU was detected in lung, liver and spleen tissues.
Chlamydia specific IgG immune response was found to be dose dependent. This study
indicated that the C. psittaci strains frequently associated with avian and human psittacosis
cases were highly virulent to mice and that the immune responses lead to variable degrees
of protection. Our murine lung infection based model can be used for further molecular
virulence analysis studies.
The chlamydial etiological investigation in ophthalmic and reproductive diseases of
animals and human showed some interesting results. The detected chlamydial species and
strains were genetically characterized by multilocus sequence analysis.
Five commercial piggeries, in three prefectures of Japan, with frequent ocular and
reproductive problems were etiologically investigated. Samples from 49 animals were
collected and screened preliminarily with FAT and then followed by nested PCR tests. C.
suis were detected in 44.9% (22 out of 49) samples in all 5 farms by 16S-23S rRNA
intergenic spacer region based PCR and Chlamydia genus-specific PCR targeting ompA
gene. Whereas, all the samples were found to be negative by ompA gene based
Chlamydophila genus specific PCR. All the PCR positive samples were accrued from
![Page 120: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/120.jpg)
115
conjunctivitis cases only. Total 9 C. suis strains with less than 3% nucleotide variation
were detected by nucleotide sequence analysis of 16S-23S rRNA intergenic spacer region,
whereas, 20 C. suis strains with up to 22% of nucleotide variation were detected by
analyzing VD2 and VD3 regions of the ompA gene. Multiple genotypes (up to 4 types)
were found infecting either individual animals or farms. This study revealed high
prevalence of C. suis in porcine chlamydiosis and association of genetically diverse,
multiple genotypes in ophthalmic infection.
Human genital tract infections by different serovars of C. trachomatis are reported
to be alarmingly higher in recent epidemiological studies. Occasionally C. abortus also
causes human reproductive disorders, whereas, C. caviae is a highly host specific species
and causes conjunctivitis and other eye infections in guinea pigs. In our study, we
characterize a C. caviae strain (OK135) isolated from a woman with acute cervicitis, by
sequencing 16S rRNA, ompA and groEL-1 genes. The isolate was confirmed as C. caviae
and phylogenetically closely related to other previously reported strains of C. caviae. The
ompA, groEL-1 and 16S rRNA genes showed 100% homology to GPIC strain of C. caviae.
This report highlights the ability of non-conventional chlamydiae to cause human
infections without many genetic and subsequent structural and physiological adjustments.
It suggests the need for broader and not species-specific diagnostic approach in human
chlamydial infections.
The results of this study showed that, though C. psittaci is widely distributed
among avian fauna, only a few strains/genotypes are epidemiologically successful and are
highly virulent to in-contact animals or human beings. In general chlamydiae may be
involved in many animal or human disease conditions but either have not yet been
investigated in detail or have escaped from clinical diagnosis due to use of very specific
diagnostic approaches.
![Page 121: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/121.jpg)
116
1. Adams, E. J., A. Charlett, W. J. Edmunds, and G. Hughes. 2004. Chlamydia
trachomatis in the United Kingdom: a systematic review and analysis of prevalence
studies. Sex. Transm. Infect. 80:354-362.
2. Alexander, E. R., S. P. Wang, and J. T. Grayston. 1967. Further classification of
TRIC agents from ocular trachoma and other sources by the mouse toxicity
prevention test. Am. J. Ophthalmol. 63:Suppl:1469-1478.
3. Andersen, A. A. 1991. Comparison of avian Chlamydia psittaci isolates by
restriction endonuclease analysis and serovar-specific monoclonal antibodies. J.
Clin. Microbiol. 29:244-249.
4. Andersen, A. A. 1991. Serotyping of Chlamydia psittaci isolates using serovar-
specific monoclonal antibodies with the microimmunofluorescence test. J. Clin.
Microbiol. 29:707-711.
5. Andersen, A. A., J. E. Grimes, and H. L. Shivaprasad. 1998. Serotyping of
Chlamydia psittaci isolates from ratites. J. Vet. Diagn. Invest. 10:186-188.
6. Andersen, A. A., and J. P. Tappe. 1989. Genetic, immunologic, and pathologic
characterization of avian chlamydial strains. J. Am. Vet. Med. Assoc. 195:1512-
1516.
7. Andersen, A. A., and D. Vanrompay. 2000. Avian chlamydiosis. Rev. Sci. Tech.
19:396-404.
8. Andersen, A. A., and D. Vanrompay. 2003. Avian Chlamydiosis (psittacosis,
ornithosis), p. 863-879. In Y. M. Saif, H. J. Barnes, J. R. Glisson, A. M. Fadly, L.
R. McDougald, and D. E. Swayne (ed.), Diseases of Poultry, 11 ed. Iowa State
Press, A Blackwell Publishing Company, Ames Iowa.
9. Anderson, D. C., P. A. Stoesz, and A. F. Kaufmann. 1978. Psittacosis outbreak in
employees of a turkey-processing plant. Am. J. Epidemiol. 107:140-148.
REFERENCES
![Page 122: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/122.jpg)
117
10. Baehr, W., Y. X. Zhang, T. Joseph, H. Su, F. E. Nano, K. D. Everett, and H. D.
Caldwell. 1988. Mapping antigenic domains expressed by Chlamydia trachomatis
major outer membrane protein genes. Proc. Natl. Acad. Sci. U. S. A. 85:4000-4004.
11. Banks, J., B. Eddie, M. Sung, N. Sugg, J. Schachter, and K. F. Meyer. 1970. Plaque
reduction technique for demonstrating neutralizing antibodies for Chlamydia.
Infect. Immun. 2:443-447.
12. Batteiger, B. E., P. M. Lin, R. B. Jones, and B. J. Van Der Pol. 1996. Species-,
serogroup-, and serovar-specific epitopes are juxtaposed in variable sequence
region 4 of the major outer membrane proteins of some Chlamydia trachomatis
serovars. Infect. Immun. 64:2839-2841.
13. Batteiger, B. E., and R. G. Rank. 1987. Analysis of the humoral immune response
to chlamydial genital infection in guinea pigs. Infect. Immun. 55:1767-1773.
14. Bedson, S. P., G. T. Western, and S. L. Simpson. 1930. Observations on the
aetiology of psittacosis. Lancet. i:235-236.
15. Bell, S. D., Jr., J. C. Snyder, and E. S. Murray. 1959. Immunization of mice against
toxic doses of homologous elementary bodies of trachoma. Science. 130:626-627.
16. Bernstein-Hanley, I., Z. R. Balsara, W. Ulmer, J. Coers, M. N. Starnbach, and W.
F. Dietrich. 2006. Genetic analysis of susceptibility to Chlamydia trachomatis in
mouse. Genes Immun. 7:122-129.
17. Bovarnick, M. R., J. C. Miller, and J. C. Snyder. 1950. The influence of certain
salts, amino acids, sugars, and proteins on the stability of rickettsiae. J. Bacteriol.
59:509-522.
18. Bracewell, C. D., and B. J. Bevan. 1986. Chlamydiosis in birds in Great Britain. 1.
Serological reactions to chlamydia in birds sampled between 1974 and 1983. J.
Hyg. (Lond.). 96:447-451.
19. Browning, G. F. 2004. Is Chlamydophila felis a significant zoonotic pathogen?
Aust. Vet. J. 82:695-696.
![Page 123: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/123.jpg)
118
20. Brunelle, B. W., and G. F. Sensabaugh. 2006. The ompA gene in Chlamydia
trachomatis differs in phylogeny and rate of evolution from other regions of the
genome. Infect. Immun. 74:578-585.
21. Brunham, R. C., C. Kuo, and W. J. Chen. 1985. Systemic Chlamydia trachomatis
infection in mice: a comparison of lymphogranuloma venereum and trachoma
biovars. Infect. Immun. 48:78-82.
22. Buendia, A. J., L. Del Rio, N. Ortega, J. Sanchez, M. C. Gallego, M. R. Caro, J. A.
Navarro, F. Cuello, and J. Salinas. 2002. B-cell-deficient mice show an exacerbated
inflammatory response in a model of Chlamydophila abortus infection. Infect.
Immun. 70:6911-6918.
23. Bulut, Y., E. Faure, L. Thomas, H. Karahashi, K. S. Michelsen, O. Equils, S. G.
Morrison, R. P. Morrison, and M. Arditi. 2002. Chlamydial heat shock protein 60
activates macrophages and endothelial cells through Toll-like receptor 4 and MD2
in a MyD88-dependent pathway. J. Immunol. 168:1435-1440.
24. Bush, R. M., and K. D. Everett. 2001. Molecular evolution of the Chlamydiaceae.
Int. J. Syst. Evol. Microbiol. 51:203-220.
25. Buxton, D. 1986. Potential danger to pregnant women of Chlamydia psittaci from
sheep. Vet. Rec. 118:510-511.
26. Cai, Y., H. Fukushi, S. Koyasu, E. Kuroda, T. Yamaguchi, and K. Hirai. 2002. An
etiological investigation of domestic cats with conjunctivitis and upper respiratory
tract disease in Japan. J. Vet. Med. Sci. 64:215-219.
27. Caldwell, H. D., J. Kromhout, and J. Schachter. 1981. Purification and partial
characterization of the major outer membrane protein of Chlamydia trachomatis.
Infect. Immun. 31:1161-1176.
28. Campbell, L. A., C. C. Kuo, S. P. Wang, and J. T. Grayston. 1990. Serological
response to Chlamydia pneumoniae infection. J. Clin. Microbiol. 28:1261-1264.
29. Carella, G., L. Marra, and T. Vallot. 1996. Hepatic psittacosis: a case of liver
abnormality diagnosed by ultrasonography. Presse Med. 25:197-198.
![Page 124: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/124.jpg)
119
30. Chahota, R., R. C. Katoch, and M. K. Batta. 1997. Prevalence of Chlamydia
psittaci among feral birds in Himachal Pradesh, India. J. Appl. Anim. Res. 12:89-
94.
31. Chahota, R., R. C. Katoch, and V. B. Joshi. 1997. Seroprevalence of Chlamydia
psittaci in domestic poultry and wild birds. Indian J. Poult. Sci. 32:67-71.
32. Chahota, R., R. C. Katoch, S. P. Singh, S. Verma, and A. Mahajan. 2000.
Concurrent outbreak of chlamydiosis and aflatoxicosis among chickens in
Himachal Pradesh, India. VETERINARSKI ARHIV. 70:207-213.
33. Chahota, R., H. Ogawa, Y. Mitsuhashi, K. Ohya, T. Yamaguchi, and H. Fukushi.
2006. Genetic diversity and epizootiology of Chlamydophila psittaci prevalent
among the captive and feral avian species based on VD2 region of ompA gene.
Microbiol. Immunol. 50:663-678.
34. Coles, A. C. 1930. Micro-organisms in psittacosis. Lancet. i:1011-1012.
35. Cox, H. U., P. G. Hoyt, R. P. Poston, T. G. Snider, 3rd, T. X. Lemarchand, and K.
L. O'Reilly. 1998. Isolation of an avian serovar of Chlamydia psittaci from a case
of bovine abortion. J. Vet. Diagn. Invest. 10:280-282.
36. Crosse, B. A. 1990. Psittacosis: a clinical review. J. Infect. 21:251-259.
37. De Schrijver, K. 1998. A psittacosis outbreak in customs officers in Antwerp
(Belgium). Bull. Inst. Marit. Trop. Med. Gdynia. 49:97-99.
38. Denamur, E., C. Sayada, A. Souriau, J. Orfila, A. Rodolakis, and J. Elion. 1991.
Restriction pattern of the major outer-membrane protein gene provides evidence for
a homogeneous invasive group among ruminant isolates of Chlamydia psittaci. J.
Gen. Microbiol. 137 (Pt 11): 2525-2530.
39. Eidson, M. 2002. Psittacosis/avian chlamydiosis. J. Am. Vet. Med. Assoc.
221:1710-1712.
40. Everett, K. D. 2000. Chlamydia and Chlamydiales: more than meets the eye. Vet.
Microbiol. 75:109-126.
![Page 125: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/125.jpg)
120
41. Everett, K. D., and A. A. Andersen. 1997. The ribosomal intergenic spacer and
domain I of the 23S rRNA gene are phylogenetic markers for Chlamydia spp. Int. J.
Syst. Bacteriol. 47:461-473.
42. Everett, K. D., A. A. Andersen, M. Plaunt, and T. P. Hatch. 1991. Cloning and
sequence analysis of the major outer membrane protein gene of Chlamydia psittaci
6BC. Infect. Immun. 59:2853-2855.
43. Everett, K. D., R. M. Bush, and A. A. Andersen. 1999. Emended description of the
order Chlamydiales, proposal of Parachlamydiaceae fam. nov. and Simkaniaceae
fam. nov., each containing one monotypic genus, revised taxonomy of the family
Chlamydiaceae, including a new genus and five new species, and standards for the
identification of organisms. Int. J. Syst. Bacteriol. 49 Pt 2:415-440.
44. Everett, K. D., L. J. Hornung, and A. A. Andersen. 1999. Rapid detection of the
Chlamydiaceae and other families in the order Chlamydiales: three PCR tests. J.
Clin. Microbiol. 37:575-580.
45. Felsenstein, J. 1985. Confidence limits on phylogenies: an approach using the
bootstrap. Evolution. 39:783-791.
46. Felsenstein, J., and G. A. Churchill. 1996. A hidden Markov model approach to
variation among sites in rate of evolution. Mol. Biol. Evol. 13:93-104.
47. Fitch, W. M., E. M. Peterson, and L. M. de la Maza. 1993. Phylogenetic analysis of
the outer-membrane-protein genes of Chlamydiae, and its implication for vaccine
development. Mol. Biol. Evol. 10:892-913.
48. Fox, J. G., H. F. Stills, B. J. Paster, F. E. Dewhirst, L. Yan, L. Palley, and K.
Prostak. 1993. Antigenic specificity and morphologic characteristics of Chlamydia
trachomatis, strain SFPD, isolated from hamsters with proliferative ileitis. Lab.
Anim. Sci. 43:405-410.
49. Francis, T. J., and T. P. Magill. 1938. An unidentified virus producing acute
meningitis and pneumonia in experimental animals. J. Exp. Med. 68:147-160.
![Page 126: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/126.jpg)
121
50. Fukushi, H., and K. Hirai. 1988. Immunochemical diversity of the major outer
membrane protein of avian and mammalian Chlamydia psittaci. J. Clin. Microbiol.
26:675-680.
51. Fukushi, H., and K. Hirai. 1989. Genetic diversity of avian and mammalian
Chlamydia psittaci strains and relation to host origin. J. Bacteriol. 171:2850-2855.
52. Fukushi, H., and K. Hirai. 1992. Proposal of Chlamydia pecorum sp. nov. for
Chlamydia strains derived from ruminants. Int. J. Syst. Bacteriol. 42:306-308.
53. Fukushi, H., and K. Hirai. 1993. Chlamydia pecorum--the fourth species of genus
Chlamydia. Microbiol. Immunol. 37:516-522.
54. Fukushi, H., and K. Hirai. 1993. Restriction fragment length polymorphisms of
rRNA as genetic markers to differentiate Chlamydia spp. Int. J. Syst. Bacteriol.
43:613-617.
55. Fukushi, H., K. Itoh, Y. Ogawa, Y. Hayashi, M. Kuzuya, K. Hirai, and S.
Shimakura. 1983. Isolation and serological survey of Chlamydia psittaci in feral
pigeons from Japan. Nippon Juigaku Zasshi. 45:847-848.
56. Fukushi, H., K. Nojiri, and K. Hirai. 1987. Monoclonal antibody typing of
Chlamydia psittaci strains derived from avian and mammalian species. J. Clin.
Microbiol. 25:1978-1981.
57. Fukushi, H., H. Ogawa, N. Minamoto, A. Hashimoto, K. Yagami, H. Tamura, S.
Shimakura, and K. Hirai. 1985. Seroepidemiological surveillance of Chlamydia
psittaci in cats and dogs in Japan. Vet. Rec. 117:503-504.
58. Fukushi, H., H. Ogawa, M. Toshimichi, O. Yasuyuki, S. Seigo, and K. Hirai. 1985.
Chlamydial complement fixing antibodies in cows, horses and pigs from 1980 to
1983. Res. Bull. Fac. Agr. Gifu Univ. 50:259-263.
59. Gaydos, C. A., T. C. Quinn, and J. J. Eiden. 1992. Identification of Chlamydia
pneumoniae by DNA amplification of the 16S rRNA gene. J. Clin. Microbiol.
30:796-800.
![Page 127: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/127.jpg)
122
60. Geens, T., A. Desplanques, M. Van Loock, B. M. Bonner, E. F. Kaleta, S.
Magnino, A. A. Andersen, K. D. Everett, and D. Vanrompay. 2005. Sequencing of
the Chlamydophila psittaci ompA gene reveals a new genotype, E/B, and the need
for a rapid discriminatory genotyping method. J. Clin. Microbiol. 43:2456-2461.
61. Geisler, W. M., R. J. Suchland, W. L. Whittington, and W. E. Stamm. 2001.
Quantitative culture of Chlamydia trachomatis: relationship of inclusion-forming
units produced in culture to clinical manifestations and acute inflammation in
urogenital disease. J. Infect. Dis. 184:1350-1354.
62. Girjes, A. A., F. N. Carrick, and M. F. Lavin. 1994. Remarkable sequence
relatedness in the DNA encoding the major outer membrane protein of Chlamydia
psittaci (koala type I) and Chlamydia pneumoniae. Gene. 138:139-142.
63. Gordon, F. B., E. Weiss, A. L. Quan, and H. R. Dressler. 1966. Observations on
guinea pig inclusion conjunctivitis agent. J. Infect. Dis. 116:203-207.
64. Grayston, J. T., C. C. Kuo, L. A. Campbell, and S. P. Wang. 1989. Chlamydia
pneumoniae sp. nov. for Chlamydia sp. strain TWAR. Int. J. Syst. Bacteriol. 39:88-
90.
65. Grayston, J. T., S. P. Wang, L. J. Yeh, and C. C. Kuo. 1985. Importance of
reinfection in the pathogenesis of trachoma. Rev. Infect. Dis. 7:717-725.
66. Green, S. T., N. W. Hamlet, L. Willocks, K. Sherry, D. H. Kennedy, C. E. Frew,
and D. Carrington. 1990. Psittacosis presenting with erythema-marginatum-like
lesions--a case report and a historical review. Clin. Exp. Dermatol. 15:225-227.
67. Gregory, D. W., and W. Schaffner. 1997. Psittacosis. Semin. Respir. Infect. 12:7-
11.
68. Gresham, A. C., C. E. Dixon, and B. J. Bevan. 1996. Domiciliary outbreak of
psittacosis in dogs: potential for zoonotic infection. Vet. Rec. 138:622-623.
69. Grimes, J. E., and F. D. Clark. 1986. Chlamydia psittaci infections of pet and other
birds in the United States in 1984. J. Infect. Dis. 153:374-375.
![Page 128: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/128.jpg)
123
70. Haag-Wackernagel, D., and H. Moch. 2004. Health hazards posed by feral pigeons.
J. Infect. 48:307-313.
71. Hahn, D. L., R. W. Dodge, and R. Golubjatnikov. 1991. Association of Chlamydia
pneumoniae (strain TWAR) infection with wheezing, asthmatic bronchitis, and
adult-onset asthma. JAMA. 266:225-230.
72. Harris, R. L., and T. W. Williams, Jr. 1985. “Contribution to the Question of
Pneumotyphus”: a discussion of the original article by J. Ritter in 1880. Rev. Infect.
Dis. 7:119-122.
73. Harrison, H. R., S. M. Lee, and D. O. Lucas. 1982. Chlamydia trachomatis
pneumonitis in the C57BL/KsJ mouse: pathologic and immunologic features. J.
Lab. Clin. Med. 100:953-962.
74. Hartley, J. C., S. Stevenson, A. J. Robinson, J. D. Littlewood, C. Carder, J.
Cartledge, C. Clark, and G. L. Ridgway. 2001. Conjunctivitis due to
Chlamydophila felis (Chlamydia psittaci feline pneumonitis agent) acquired from a
cat: case report with molecular characterization of isolates from the patient and cat.
J. Infect. 43:7-11.
75. Hatch, T. P. 1999. Developmental Biology, p. 29-67. In R. S. Stephens (ed.),
Chlamydia: intracellular biology, pathogenesis and immunity. American Society
for Microbiology, Washington, DC.
76. Heddema, E. R., S. Ter Sluis, J. A. Buys, C. M. Vandenbroucke-Grauls, J. H. van
Wijnen, and C. E. Visser. 2006. Prevalence of Chlamydophila psittaci in fecal
droppings from feral pigeons in Amsterdam, The Netherlands. Appl. Environ.
Microbiol. 72:4423-4425.
77. Heddema, E. R., E. J. van Hannen, B. Duim, B. M. de Jongh, J. A. Kaan, R. van
Kessel, J. T. Lumeij, C. E. Visser, and C. M. Vandenbroucke-Grauls. 2006. An
outbreak of psittacosis due to Chlamydophila psittaci genotype A in a veterinary
teaching hospital. J. Med. Microbiol. 55:1571-1575.
![Page 129: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/129.jpg)
124
78. Herrmann, B., H. Persson, J. K. Jensen, H. D. Joensen, M. Klint, and B. Olsen.
2006. Chlamydophila psittaci in Fulmars, the Faroe Islands. Emerg. Infect. Dis.
12:330-332.
79. Herrmann, B., R. Rahman, S. Bergstrom, J. Bonnedahl, and B. Olsen. 2000.
Chlamydophila abortus in a Brown skua (Catharacta antarctica lonnbergi) from a
subantarctic island. Appl. Environ. Microbiol. 66:3654-3656.
80. Hewinson, R. G., S. E. Rankin, B. J. Bevan, M. Field, and M. J. Woodward. 1991.
Detection of Chlamydia psittaci from avian field samples using the PCR. Vet. Rec.
128:129-130.
81. Hill, J. E., S. H. Goh, D. M. Money, M. Doyle, A. Li, W. L. Crosby, M. Links, A.
Leung, D. Chan, and S. M. Hemmingsen. 2005. Characterization of vaginal
microflora of healthy, nonpregnant women by chaperonin-60 sequence-based
methods. Am. J. Obstet. Gynecol. 193:682-692.
82. Hoelzle, L. E., G. Steinhausen, and M. M. Wittenbrink. 2000. PCR-based detection
of chlamydial infection in swine and subsequent PCR-coupled genotyping of
chlamydial omp1-gene amplicons by DNA-hybridization, RFLP-analysis, and
nucleotide sequence analysis. Epidemiol. Infect. 125:427-439.
83. Holland, S. M., C. A. Gaydos, and T. C. Quinn. 1990. Detection and differentiation
of Chlamydia trachomatis, Chlamydia psittaci, and Chlamydia pneumoniae by
DNA amplification. J. Infect. Dis. 162:984-987.
84. Hotzel, H., A. Berndt, F. Melzer, and K. Sachse. 2004. Occurrence of
Chlamydiaceae spp. in a wild boar (Sus scrofa L.) population in Thuringia
(Germany). Vet. Microbiol. 103:121-126.
85. Hughes, C., P. Maharg, P. Rosario, M. Herrell, D. Bratt, J. Salgado, and D.
Howard. 1997. Possible nosocomial transmission of psittacosis. Infect. Control
Hosp. Epidemiol. 18:165-168.
86. Hughes, E. S., K. M. Shaw, and R. H. Ashley. 2001. Mutagenesis and functional
reconstitution of chlamydial major outer membrane proteins: VS4 domains are not
![Page 130: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/130.jpg)
125
required for pore formation but modify channel function. Infect. Immun. 69:1671-
1678.
87. Hyde, S. R., and K. Benirschke. 1997. Gestational psittacosis: case report and
literature review. Mod. Pathol. 10:602-607.
88. Illner, V. F. 1960. Zur Frage der Ubertragung des Ornithosevirus durch das Ei.
Monatsh. Veterinarinaermed. 17:116-117.
89. Imai, H., H. Shinohara, H. Nakao, H. Tsukino, R. Hamasuna, and T. Katoh. 2004.
Prevalence and risk factors of asymptomatic chlamydial infection among students
in Japan. Int. J. STD AIDS. 15:408-414.
90. Jo, K., Y. Ohta, J. Kitahara, T. Kodama, and E. Takahashi. 1962. Isolation of a
virus from sputum and blood of a case of psittacosis. Jpn. Med. J. 1998:31-34.
91. Jones, D. T., W. R. Taylor, and J. M. Thornton. 1992. The rapid generation of
mutation data matrices from protein sequences. CABIOS. 8:275-282.
92. Joyee, A. G., S. P. Thyagarajan, P. Rajendran, R. Hari, P. Balakrishnan, L.
Jeyaseelan, and T. Kurien. 2004. Chlamydia trachomatis genital infection in
apparently healthy adult population of Tamil Nadu, India: a population-based
study. Int. J. STD AIDS. 15:51-55.
93. Jukes, T. H., and C. R. Cantor. 1969. Evolution of protein molecules, p. 21–132. In
H. N. Munro (ed.), Mammalian protein metabolism, vol. III. Academic Press, New
York.
94. Kaleta, E. F., and E. M. Taday. 2003. Avian host range of Chlamydophila spp.
based on isolation, antigen detection and serology. Avian Pathol. 32:435–462.
95. Kaltenbock, B., N. Schmeer, and R. Schneider. 1997. Evidence for numerous omp1
alleles of porcine Chlamydia trachomatis and novel chlamydial species obtained by
PCR. J. Clin. Microbiol. 35:1835-1841.
96. Kaltenboeck, B., K. G. Kousoulas, and J. Storz. 1991. Detection and strain
differentiation of Chlamydia psittaci mediated by a two-step polymerase chain
reaction. J. Clin. Microbiol. 29:1969-1975.
![Page 131: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/131.jpg)
126
97. Kaltenboeck, B., K. G. Kousoulas, and J. Storz. 1992. Two-step polymerase chain
reactions and restriction endonuclease analyses detect and differentiate ompA DNA
of Chlamydia spp. J. Clin. Microbiol. 30:1098-1104.
98. Kaltenboeck, B., K. G. Kousoulas, and J. Storz. 1993. Structures of and allelic
diversity and relationships among the major outer membrane protein (ompA) genes
of the four chlamydial species. J. Bacteriol. 175:487-502.
99. Kaltenboeck, B., and J. Storz. 1992. Biological properties and genetic analysis of
the ompA locus in chlamydiae isolated from swine. Am. J. Vet. Res. 53:1482-1487.
100. Kauffold, J., F. Melzer, K. Henning, K. Schulze, C. Leiding, and K. Sachse. 2006.
Prevalence of chlamydiae in boars and semen used for artificial insemination.
Theriogenology. 65:1750-1758.
101. Kazdan, J. J., J. Schachter, and M. Okumoto. 1967. Inclusion conjunctivitis in the
guinea pig. Am. J. Ophthalmol. 64:116-124.
102. Kishino, H., and M. Hasegawa. 1989. Evaluation of the maximum likelihood
estimate of the evolutionary tree topologies from DNA sequence data, and the
branching order in hominoidea. J. Mol. Evol. 29:170-179.
103. Kol, A., A. H. Lichtman, R. W. Finberg, P. Libby, and E. A. Kurt-Jones. 2000.
Cutting edge: heat shock protein (HSP) 60 activates the innate immune response:
CD14 is an essential receptor for HSP60 activation of mononuclear cells. J.
Immunol. 164:13-17.
104. Kuo, C., and W. J. Chen. 1980. A mouse model of Chlamydia trachomatis
pneumonitis. J. Infect. Dis. 141:198-202.
105. Kuo, C. C., and L. A. Campbell. 2003. Chlamydial infections of the cardiovascular
system. Front. Biosci. 8:e36-43.
106. Kuo, C. C., L. A. Jackson, L. A. Campbell, and J. T. Grayston. 1995. Chlamydia
pneumoniae (TWAR). Clin. Microbiol. Rev. 8:451-461.
![Page 132: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/132.jpg)
127
107. Kuwabara, M., N. Tanemori, Y. Kawaguti, K. Nakamura, S. Nomiyama, M.
Terada, Y. Mitsutou, K. Imura, and M. Yamakido. 1990. Clinical features of 36
cases of psittacosis. Kansenshogaku Zasshi. 64:498-503.
108. Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of the
head of bacteriophage T4. Nature. 227:680-685.
109. Levison, D. A., W. Guthrie, C. Ward, D. M. Green, and P. G. Robertson. 1971.
Infective endocarditis as part of psittacosis. Lancet. 2:844-847.
110. Li, Y., M. Wexler, D. J. Richardson, P. L. Bond, and A. W. Johnston. 2005.
Screening a wide host-range, waste-water metagenomic library in tryptophan
auxotrophs of Rhizobium leguminosarum and of Escherichia coli reveals different
classes of cloned trp genes. Environ. Microbiol. 7:1927-1936.
111. Lillie, R. D. 1930. Psittacosis: rickettsia-like inclusions in man and in experimental
animals. Public Health Rep. 45:773-778.
112. Lipman, N. S., L. L. Yan, and J. C. Murphy. 1994. Probable transmission of
Chlamydia psittaci from a macaw to a cat. J. Am. Vet. Med. Assoc. 204:1479-
1480.
113. Longbottom, D., and L. J. Coulter. 2003. Animal chlamydioses and zoonotic
implications. J. Comp. Pathol. 128:217-244.
114. Lutz-Wohlgroth, L., A. Becker, E. Brugnera, Z. L. Huat, D. Zimmermann, F.
Grimm, M. Haessig, G. Greub, S. Kaps, B. Spiess, A. Pospischil, and L. Vaughan.
2006. Chlamydiales in guinea-pigs and their zoonotic potential. J. Vet .Med. A
Physiol. Pathol. Clin. Med. 53:185-193.
115. Macfarlane, J. T., and A. D. Macrae. 1983. Psittacosis. Br. Med. Bull. 39:163-167.
116. Maegawa, N., T. Emoto, H. Mori, D. Yamaguchi, T. Fujinaga, N. Tezuka, N.
Sakai, N. Ohtsuka, and T. Fukuse. 2001. Two cases of Chlamydia psittaci infection
occurring in employees of the same pet shop. Nihon Kokyuki Gakkai Zasshi.
39:753-757.
![Page 133: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/133.jpg)
128
117. Maffei, C., A. Marracino, F. Di Stanislao, P. Pauri, M. Clementi, and P. E. Varaldo.
1987. Psittacosis in a highly endemic area in Italy. Epidemiol. Infect. 99:413-419.
118. Malaty, R., C. R. Dawson, I. Wong, C. Lyon, and J. Schachter. 1981. Serum and
tear antibodies to Chlamydia after reinfection with guinea pig inclusion
conjunctivitis agent. Invest. Ophthalmol. Vis. Sci. 21:833-841.
119. Matsumoto, A. 1988. Structural characteristics of chlamydial bodies, p. 21-45. In
A. L. Barron (ed.), Microbiology of chlamydia. CRC Press, Boca Raton, Florida.
120. Matsumoto, A., H. Bessho, R. Soejima, and J. Hino. 1984. Biological Properties of
a Chlamydia strain isolated from a pet bird, budgerigar which was kept by a
psittacosis patient. Kawasaki Med. J. 10:77-90.
121. Matsumoto, A., H. Izutsu, N. Miyashita, and M. Ohuchi. 1998. Plaque formation
by and plaque cloning of Chlamydia trachomatis biovar trachoma. J. Clin.
Microbiol. 36:3013-3019.
122. Matsumoto, A., W. Murao, H. Kumon, H. Fukushi, and R. Chahota. 2004.
Characteristics of Chlamydia sp. isolated from cervicitis. Infectious agents
surveillance report Vol. 25 No. 8 (No. 294). Infectious disease surveillance center,
National institute of infectious diseases, Japan.
123. Matsushima, H., N. Takayanagi, M. Ubukata, D. Tokunaga, S. Mori, N. Sato, K.
Kurashima, T. Yanagisawa, Y. Sugita, and M. Kanazawa. 2002. A case of
fulminant psittacosis with rhabdomyolysis. Nihon Kokyuki Gakkai Zasshi. 40:612-
616.
124. May, S. W., C. L. Kelling, M. Sabara, and J. Sandbulte. 1996. Virulence of feline
Chlamydia psittaci in mice is not a function of the major outer membrane protein
(MOMP). Vet. Microbiol. 53:355-368.
125. McClarty, G., H. Fan, and A. A. Andersen. 1993. Diversity in nucleotide
acquisition by antigenically similar Chlamydia psittaci of avian origin. FEMS
Microbiol. Lett. 108:325-331.
![Page 134: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/134.jpg)
129
126. McClenaghan, M., A. J. Herring, and I. D. Aitken. 1984. Comparison of Chlamydia
psittaci isolates by DNA restriction endonuclease analysis. Infect. Immun. 45:384-
389.
127. Meyer, K. F. 1965. Ornithosis, p. 675-770. In H. E. Biester and L. H. Schwarte
(ed.), Diseases of poultry, 5 ed. The Iowa State University Press, Ames Iowa.
128. Miyairi, I., O. S. Mahdi, S. P. Ouellette, R. J. Belland, and G. I. Byrne. 2006.
Different growth rates of Chlamydia trachomatis biovars reflect pathotype. J.
Infect. Dis. 194:350-357.
129. Morange, A. 1895. De la psittacose, ou infection spéciale déterminée par des
perruches. PhD Thesis. Academie de Paris, France, Paris.
130. Morrison, R. P., K. Lyng, and H. D. Caldwell. 1989. Chlamydial disease
pathogenesis. Ocular hypersensitivity elicited by a genus-specific 57-kD protein. J.
Exp. Med. 169:663-675.
131. Moulder, J. W. 1991. Interaction of chlamydiae and host cells in vitro. Microbiol.
Rev. 55:143-190.
132. Moulder, J. W., T. P. Hatch, C. C. Kao, J. Schachter, and J. Storz. 1984. Genus
Chlamydia, p. 729-739. In N. R. Krieg (ed.), Bergey's manual of systematic
bacteriology, vol. 1. Baltimore: Williams and Wilkins.
133. Mueller, M., S. Postius, J. G. Thimm, K. Gueinzius, I. Muehldorfer, and C.
Hermann. 2004. Toll-like receptors 2 and 4 do not contribute to clearance of
Chlamydophila pneumoniae in mice, but are necessary for the release of
monokines. Immunobiology. 209:599-608.
134. Mukai, S., C. Mukai, K. Asaoka, and I. Suzuki. 1985. Chlamydial infection with
main symptoms of upper cervical lymphadenitis (UCLA). Isolation of chlamydiae.
Nippon Jibiinkoka Gakkai Kaiho. 88:1200-1206.
135. Murray, E. S. 1964. Guinea pig inclusion conjunctivitis virus. I. Isolation and
identification as a member of the Psittacosis-Lymphogranuloma-Trachoma group.
J. Infect. Dis. 114:1-12.
![Page 135: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/135.jpg)
130
136. National institute of infectious diseases. 2002. Psittacosis in Japan, 1999-2002.
Infectious Agents Surveillance Report Vol. 23 No. 10 (No 272). Infectious disease
surveillance center, National institute of infectious diseases, Japan.
137. Nelson, D. E., D. P. Virok, H. Wood, C. Roshick, R. M. Johnson, W. M. Whitmire,
D. D. Crane, O. Steele-Mortimer, L. Kari, G. McClarty, and H. D. Caldwell. 2005.
Chlamydial IFN-gamma immune evasion is linked to host infection tropism. Proc.
Natl. Acad. Sci. U. S. A. 102:10658-10663.
138. Newton, P., A. Lalvani, and C. P. Conlon. 1996. Psittacosis associated with
bilateral 4th cranial nerve palsies. J. Infect. 32:63-65.
139. Okada, N., S. Murakami, R. Miwa, Y. Hara, T. Murashima, N. Ito, Y. Okazaki, T.
Yamaguchi, and K. Hirai. 1992. Occurrence of chlamydial abortion in swine. J.
Jpn. Vet. Med. Assoc. 45:655-659.
140. Olson, B. J., and W. L. Treuting. 1944. Epidemic of severe pneumonitis in bayou
region of Louisiana; epidemiological study. Public Health Rep. 59:1299-1316.
141. Page, L. A. 1958. Measurement of pathogenicity of turkey ornithosis agents for
mice. Avian Dis. 3:23-27.
142. Page, L. A. 1959. Experimental ornithosis in turkeys. Avian Dis. 3:51-66.
143. Page, L. A. 1967. Comparison of “pathotypes’’ among chlamydial (psittacosis)
strains recovered from diseased birds and mammals. Bull. Wildl. Dis. Assoc.
3:166-175.
144. Page, L. A. 1976. Observations on the involvement of wildlife in an epornitic of
chlamydiosis in domestic turkeys. J. Am. Vet. Med. Assoc. 169:932-935.
145. Page, L. A., and R. A. Bankowski. 1960. Factors affecting the production and
detection of ornithosis antibodies in infected turkeys. Am. J. Vet. Res. 21:971-978.
146. Palmer, S. R. 1982. Psittacosis in man - recent developments in the UK: a review.
J. R. Soc. Med. 75:262-267.
![Page 136: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/136.jpg)
131
147. Pickett, M. A., J. S. Everson, and I. N. Clarke. 1988. Chlamydia psittaci ewe
abortion agent: Complete nucleotide sequence of the major outer membrane protein
gene. FEMS Microbiol. Lett. 55:229-234.
148. Poole, E., and I. Lamont. 1992. Chlamydia trachomatis serovar differentiation by
direct sequence analysis of the variable segment 4 region of the major outer
membrane protein gene. Infect. Immun. 60:1089-1094.
149. Pudjiatmoko, H. Fukushi, Y. Ochiai, T. Yamaguchi, and K. Hirai. 1997.
Phylogenetic analysis of the genus Chlamydia based on 16S rRNA gene sequences.
Int. J. Syst. Bacteriol. 47:425-431.
150. Rank, R. G., A. K. Bowlin, R. L. Reed, and T. Darville. 2003. Characterization of
chlamydial genital infection resulting from sexual transmission from male to
female guinea pigs and determination of infectious dose. Infect. Immun. 71:6148-
6154.
151. Rank, R. G., and M. M. Sanders. 1992. Pathogenesis of endometritis and salpingitis
in a guinea pig model of chlamydial genital infection. Am. J. Pathol. 140:927-936.
152. Rank, R. G., H. J. White, and A. L. Barron. 1979. Humoral immunity in the
resolution of genital infection in female guinea pigs infected with the agent of
guinea pig inclusion conjunctivitis. Infect. Immun. 26:573-579.
153. Read, T. D., G. S. Myers, R. C. Brunham, W. C. Nelson, I. T. Paulsen, J.
Heidelberg, E. Holtzapple, H. Khouri, N. B. Federova, H. A. Carty, L. A. Umayam,
D. H. Haft, J. Peterson, M. J. Beanan, O. White, S. L. Salzberg, R. C. Hsia, G.
McClarty, R. G. Rank, P. M. Bavoil, and C. M. Fraser. 2003. Genome sequence of
Chlamydophila caviae (Chlamydia psittaci GPIC): examining the role of niche-
specific genes in the evolution of the Chlamydiaceae. Nucleic Acids Res. 31:2134-
2147.
154. Reed, L. J., and H. Muench. 1938. A simple method of estimating fifty percent
endpoints. Am. J. Hyg. 27:493-497.
155. Riantawan, P., and P. Nunthapisud. 1996. Psittacosis pneumonia: a case report and
review of the literature. J. Med. Assoc. Thai. 79:55-59.
![Page 137: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/137.jpg)
132
156. Richmond, S. J., and E. O. Caul. 1975. Fluorescent antibody studies in chlamydial
infections. J. Clin. Microbiol. 1:345-352.
157. Richmond, S. J., P. Stirling, and C. R. Ashley. 1982. Virus infecting the reticulate
bodies of an avian strain of Chlamydia psittaci. FEMS Microbiol. Lett. 14:31-36.
158. Ritter, J. 1880. Beitrag zur Frage des Pneumotyphus (Eine Hausepidemie in Uster
[Schweiz] betreffend). Deutsches Archiv für Klinische Medizin. 25:53-96.
159. Rodolakis, A., F. Bernard, and F. Lantier. 1989. Mouse models for evaluation of
virulence of Chlamydia psittaci isolated from ruminants. Res. Vet. Sci. 46:34-39.
160. Rodolakis, A., J. Salinas, and J. Papp. 1998. Recent advances on ovine chlamydial
abortion. Vet. Res. 29:275-288.
161. Rodolakis, A., and A. Souriau. 1989. Variations in the virulence of strains of
Chlamydia psittaci for pregnant ewes. Vet. Rec. 125:87-90.
162. Rodolakis, A., and A. Souriau. 1992. Restriction endonuclease analysis of DNA
from ruminant Chlamydia psittaci and its relation to mouse virulence. Vet.
Microbiol. 31:263-271.
163. Rogers, D. G., and A. A. Andersen. 1999. Conjunctivitis caused by a swine
Chlamydia trachomatis-like organism in gnotobiotic pigs. J. Vet. Diagn. Invest.
11:341-344.
164. Rogers, D. G., and A. A. Andersen. 2000. Intestinal lesions caused by a strain of
Chlamydia suis in weanling pigs infected at 21 days of age. J. Vet. Diagn. Invest.
12:233-239.
165. Rogers, D. G., A. A. Andersen, A. Hogg, D. L. Nielsen, and M. A. Huebert. 1993.
Conjunctivitis and keratoconjunctivitis associated with chlamydiae in swine. J. Am.
Vet. Med. Assoc. 203:1321-1323.
166. Rogers, D. G., A. A. Andersen, and B. D. Hunsaker. 1996. Lung and nasal lesions
caused by a swine chlamydial isolate in gnotobiotic pigs. J. Vet. Diagn. Invest.
8:45-55.
![Page 138: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/138.jpg)
133
167. Sachse, K., E. Grossmann, A. Berndt, C. Schutt, K. Henning, D. Theegarten, O.
Anhenn, and P. Reinhold. 2004. Respiratory chlamydial infection based on
experimental aerosol challenge of pigs with Chlamydia suis. Comp. Immunol.
Microbiol. Infect. Dis. 27:7-23.
168. Saeki, S., I. Hirata, T. Fukusako, K. Negoro, H. Nogaki, and M. Morimatsu. 1996.
A case of psittacosis with psychiatric symptoms, abnormal EEG, and abnormal
SPECT. No To Shinkei. 48:1141-1145.
169. Saikku, P., and J. Paavonen. 1978. Single-antigen immunofluorescence test for
chlamydial antibodies. J. Clin. Microbiol. 8:119-122.
170. Saitou, N., and M. Nei. 1987. The neighbor-joining method: a new method for
reconstructing phylogenetic trees. Mol. Biol. Evol. 4:406-425.
171. Sambrook, J., and W. D. Russell. 2001. Molecular cloning: a laboratory manual, 3
ed, vol. 1. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York.
172. Samra, Z., A. Pik, A. Guidetti-Sharon, E. Yona, and Y. Weisman. 1991. Hepatitis
in a family infected by Chlamydia psittaci. J. R. Soc. Med. 84:347-348.
173. Sayada, C., A. Andersen, P. Rodriguez, F. Eb, A. Milon, J. Elion, and E. Denamur.
1994. Homogeneity of the major outer membrane protein gene of feline Chlamydia
psittaci. Res. Vet. Sci. 56:116-118.
174. Sayada, C., A. A. Andersen, C. Storey, A. Milon, F. Eb, N. Hashimoto, K. Hirai, J.
Elion, and E. Denamur. 1995. Usefulness of omp1 restriction mapping for avian
Chlamydia psittaci isolate differentiation. Res. Microbiol. 146:155-165.
175. Schachter, J. 1988. Chlamydiaceae: The chlamydiae, p. 847-890. In E. H. Lennette,
P. Halonen, and F. A. Murphy (ed.), Laboratory diagnosis of infectious diseases:
principles and practice: viral, rickettsial and chlamydial diseases., vol. 2. Springer-
Verlag, New York.
176. Schachter, J. 1990. Chlamydial infections. West. J. Med. 153:523-534.
![Page 139: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/139.jpg)
134
177. Schachter, J. 1999. Infection and disease epidemiology, p. 139–169. In R. S.
Stephens (ed.), Chlamydia: intracellular biology, pathogenesis, and immunity.
American Society for Microbiology, Washington, DC.
178. Schiller, I., R. Koesters, R. Weilenmann, B. Kaltenboeck, and A. Pospischil. 1997.
Polymerase chain reaction (PCR) detection of porcine Chlamydia trachomatis and
ruminant Chlamydia psittaci serovar 1 DNA in formalin-fixed intestinal specimens
from swine. Zentralbl. Veterinarmed. B 44:185-191.
179. Schiller, I., R. Koesters, R. Weilenmann, R. Thoma, B. Kaltenboeck, P. Heitz, and
A. Pospischil. 1997. Mixed infections with porcine Chlamydia
trachomatis/pecorum and infections with ruminant Chlamydia psittaci serovar 1
associated with abortions in swine. Vet. Microbiol. 58:251-260.
180. Semel, J. D. 1984. Cutaneous findings in a case of psittacosis. Arch. Dermatol.
120:1227-1229.
181. Smith, K. A., K. K. Bradley, M. G. Stobierski, and L. A. Tengelsen. 2005.
Compendium of measures to control Chlamydophila psittaci (formerly Chlamydia
psittaci) infection among humans (psittacosis) and pet birds, 2005. J. Am. Vet.
Med. Assoc. 226:532-539.
182. Spalatin, J., C. E. Fraser, R. Connell, R. P. Hanson, and D. T. Berman. 1966.
Agents of psittacosis-lymphogranuloma venereum group isolated from muskrats
and snowshoe hares in Saskatchewan. Can. J. Comp. Med. Vet. Sci. 30:260-264.
183. Spears, P., and J. Storz. 1979. Biotyping of Chlamydia psittaci based on inclusion
morphology and response to diethylaminoethyl-dextran and cycloheximide. Infect.
Immun. 24:224-232.
184. Spears, P., and J. Storz. 1979. Chlamydia psittaci: growth characteristics and
enumeration of serotypes 1 and 2 in cultured cells. J. Infect. Dis. 140:959-967.
185. Stephens, R. S. 1999. Chlamydia: intracellular biology, pathology, and immunity.
American Society for Microbiology, Washington, DC.
![Page 140: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/140.jpg)
135
186. Stephens, R. S., R. Sanchez-Pescador, E. A. Wagar, C. Inouye, and M. S. Urdea.
1987. Diversity of Chlamydia trachomatis major outer membrane protein genes. J.
Bacteriol. 169:3879-3885.
187. Stephens, R. S., M. R. Tam, C. C. Kuo, and R. C. Nowinski. 1982. Monoclonal
antibodies to Chlamydia trachomatis: antibody specificities and antigen
characterization. J. Immunol. 128:1083-1089.
188. Storz, J. 1971. Chlamydia and chlamydia-induced diseases. Charles C Thomas
Publisher, Limited, Springfield.
189. Stothard, D. R., G. Boguslawski, and R. B. Jones. 1998. Phylogenetic analysis of
the Chlamydia trachomatis major outer membrane protein and examination of
potential pathogenic determinants. Infect. Immun. 66:3618-3625.
190. Sturm-Ramirez, K., H. Brumblay, K. Diop, A. Gueye-Ndiaye, J. L. Sankale, I.
Thior, I. N'Doye, C. C. Hsieh, S. Mboup, and P. J. Kanki. 2000. Molecular
epidemiology of genital Chlamydia trachomatis infection in high-risk women in
Senegal, West Africa. J. Clin. Microbiol. 38:138-145.
191. Sudler, C., L. E. Hoelzle, I. Schiller, and R. K. Hoop. 2004. Molecular
characterisation of chlamydial isolates from birds. Vet. Microbiol. 98:235-241.
192. Sykes, J. E. 2005. Feline chlamydiosis. Clin. Tech. Small Anim. Pract. 20:129-134.
193. Takahashi, T., M. Masuda, T. Tsuruno, Y. Mori, I. Takashima, T. Hiramune, and
N. Kikuchi. 1997. Phylogenetic analyses of Chlamydia psittaci strains from birds
based on 16S rRNA gene sequence. J. Clin. Microbiol. 35:2908-2914.
194. Tamura, A., and N. Higashi. 1963. Purification and chemical composition of
meningopneumonitis virus. Virology. 20:596-604.
195. Taylor, H. R., S. L. Johnson, R. A. Prendergast, J. Schachter, C. R. Dawson, and A.
M. Silverstein. 1982. An animal model of trachoma II. The importance of repeated
reinfection. Invest. Ophthalmol. Vis. Sci. 23:507-515.
![Page 141: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/141.jpg)
136
196. Teankum, K., A. Pospischil, F. Janett, E. Burgi, E. Brugnera, K. Hoelzle, A.
Polkinghorne, R. Weilenmann, D. R. Zimmermann, and N. Borel. 2006. Detection
of chlamydiae in boar semen and genital tracts. Vet. Microbiol. 116:149-157.
197. Telfer, B. L., S. A. Moberley, K. P. Hort, J. M. Branley, D. E. Dwyer, D. J.
Muscatello, P. K. Correll, J. England, and J. M. McAnulty. 2005. Probable
psittacosis outbreak linked to wild birds. Emerg. Infect. Dis. 11:391-397.
198. Thompson, J. D., T. J. Gibson, F. Plewniak, F. Jeanmougin, and D. G. Higgins.
1997. The CLUSTAL_X windows interface: flexible strategies for multiple
sequence alignment aided by quality analysis tools. Nucleic Acids Res. 25:4876-
4882.
199. Thomson, N. R., C. Yeats, K. Bell, M. T. Holden, S. D. Bentley, M. Livingstone,
A. M. Cerdeno-Tarraga, B. Harris, J. Doggett, D. Ormond, K. Mungall, K. Clarke,
T. Feltwell, Z. Hance, M. Sanders, M. A. Quail, C. Price, B. G. Barrell, J. Parkhill,
and D. Longbottom. 2005. The Chlamydophila abortus genome sequence reveals
an array of variable proteins that contribute to interspecies variation. Genome Res.
15:629-640.
200. Timms, P., F. W. Eaves, A. A. Girjes, and M. F. Lavin. 1988. Comparison of
Chlamydia psittaci isolates by restriction endonuclease and DNA probe analyses.
Infect. Immun. 56:287-290.
201. Toyokawa, M., T. Kishimoto, Y. Cai, M. Ogawa, S. Shiga, I. Nishi, H. Hosotsubo,
M. Horikawa, and S. Asari. 2004. Severe Chlamydophila psittaci pneumonia
rapidly diagnosed by detection of antigen in sputum with an
immunochromatography assay. J. Infect. Chemother. 10:245-249.
202. Travnicek, M., L. Cislakova, W. Deptula, M. Stosik, and M. R. Bhide. 2002. Wild
pigeons and pheasants--a source of Chlamydophila psittaci for humans and
animals. Ann. Agric. Environ. Med. 9:253-255.
203. Treharne, J. D., and A. Shallal. 1991. The antigenic specificity of the humoral
immune response to primary and repeated ocular infections of the guinea pig with
the GPIC agent (Chlamydia psittaci). Eye. 5 (Pt 3):299-304.
![Page 142: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/142.jpg)
137
204. van Bergen, J., H. M. Gotz, J. H. Richardus, C. J. Hoebe, J. Broer, and A. J.
Coenen. 2005. Prevalence of urogenital Chlamydia trachomatis increases
significantly with level of urbanisation and suggests targeted screening approaches:
results from the first national population based study in the Netherlands. Sex.
Transm. Infect. 81:17-23.
205. Van Loock, M., D. Vanrompay, B. Herrmann, J. Vander Stappen, G. Volckaert, B.
M. Goddeeris, and K. D. Everett. 2003. Missing links in the divergence of
Chlamydophila abortus from Chlamydophila psittaci. Int. J. Syst. Evol. Microbiol.
53:761-770.
206. Vanrompay, D., A. A. Andersen, R. Ducatelle, and F. Haesebrouck. 1993.
Serotyping of European isolates of Chlamydia psittaci from poultry and other birds.
J. Clin. Microbiol. 31:134-137.
207. Vanrompay, D., P. Butaye, C. Sayada, R. Ducatelle, and F. Haesebrouck. 1997.
Characterization of avian Chlamydia psittaci strains using omp1 restriction
mapping and serovar-specific monoclonal antibodies. Res. Microbiol. 148:327-333.
208. Vanrompay, D., E. Cox, J. Mast, B. Goddeeris, and G. Volckaert. 1998. High-level
expression of Chlamydia psittaci major outer membrane protein in COS cells and
in skeletal muscles of turkeys. Infect. Immun. 66:5494-5500.
209. Vanrompay, D., W. De Meurichy, R. Ducatelle, and F. Haesebrouck. 1994.
Pneumonia in Moorish tortoises (Testudo graeca) associated with avian serovar A
Chlamydia psittaci. Vet. Rec. 135:284-285.
210. Vanrompay, D., R. Ducatelle, and F. Haesebrouck. 1995. Chlamydia psittaci
infections: a review with emphasis on avian chlamydiosis. Vet. Microbiol. 45:93-
119.
211. Vanrompay, D., T. Geens, A. Desplanques, T. Q. Hoang, L. De Vos, M. Van
Loock, E. Huyck, C. Mirry, and E. Cox. 2004. Immunoblotting, ELISA and culture
evidence for Chlamydiaceae in sows on 258 Belgian farms. Vet. Microbiol. 99:59-
66.
![Page 143: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/143.jpg)
138
212. Vanrompay, D., J. Mast, R. Ducatelle, F. Haesebrouck, and B. Goddeeris. 1995.
Chlamydia psittaci in turkeys: pathogenesis of infections in avian serovars A, B
and D. Vet. Microbiol. 47:245-256.
213. Verweij, P. E., J. F. Meis, R. Eijk, W. J. Melchers, and J. M. Galama. 1995. Severe
human psittacosis requiring artificial ventilation: case report and review. Clin.
Infect. Dis. 20:440-442.
214. Virok, D. P., D. E. Nelson, W. M. Whitmire, D. D. Crane, M. M. Goheen, and H.
D. Caldwell. 2005. Chlamydial infection induces pathobiotype-specific protein
tyrosine phosphorylation in epithelial cells. Infect. Immun. 73:1939-1946.
215. Volp, K., S. Mathews, P. Timms, and L. Hafner. 2001. Peptide immunization of
guinea pigs against Chlamydia psittaci (GPIC agent) infection induces good
vaginal secretion antibody response, in vitro neutralization and partial protection
against live challenge. Immunol. Cell Biol. 79:245-250.
216. Ward, M. E. 1988. The chlamydial developmental cycle, p. 71-96. In A. L. Barron
(ed.), Microbiology of chlamydia. CRC Press, Boca Raton, Florida.
217. Ward, M. E. 1999. Mechanisms of chlamydia-induced disease p. 171-210. In R. S.
Stephens (ed.), Chlamydia: intracellular biology, pathogenesis and immunity.
American Society for Microbiology, Washington, DC.
218. Wills, J. M., G. Watson, M. Lusher, T. S. Mair, D. Wood, and S. J. Richmond.
1990. Characterisation of Chlamydia psittaci isolated from a horse. Vet. Microbiol.
24:11-19.
219. Winsor, D. K., Jr., and J. E. Grimes. 1988. Relationship between infectivity and
cytopathology for L-929 cells, membrane proteins, and antigenicity of avian
isolates of Chlamydia psittaci. Avian Dis. 32:421-431.
220. Wong, K. H., S. K. Skelton, and H. Daugharty. 1994. Utility of complement
fixation and microimmunofluorescence assays for detecting serologic responses in
patients with clinically diagnosed psittacosis. J. Clin. Microbiol. 32:2417-2421.
![Page 144: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/144.jpg)
139
221. Yamashita, T., and K. Hirai. 1981. Isolation of Chlamydia psittaci from imported
psittacine birds in Japan. Nippon Juigaku Zasshi. 43:561-563.
222. Yan, C., H. Fukushi, H. Matsudate, K. Ishihara, K. Yasuda, H. Kitagawa, T.
Yamaguchi, and K. Hirai. 2000. Seroepidemiological investigation of feline
chlamydiosis in cats and humans in Japan. Microbiol. Immunol. 44:155-160.
223. Yang, Z. P., C. C. Kuo, and J. T. Grayston. 1993. A mouse model of Chlamydia
pneumoniae strain TWAR pneumonitis. Infect. Immun. 61:2037-2040.
224. Yung, A. P., and M. L. Grayson. 1988. Psittacosis--a review of 135 cases. Med. J.
Aust. 148:228-233.
225. Zhang, Y. X., J. G. Fox, Y. Ho, L. Zhang, H. F. Stills, Jr., and T. F. Smith. 1993.
Comparison of the major outer-membrane protein (MOMP) gene of mouse
pneumonitis (MoPn) and hamster SFPD strains of Chlamydia trachomatis with
other Chlamydia strains. Mol. Biol. Evol. 10:1327-1342.
226. Zhang, Y. X., S. G. Morrison, H. D. Caldwell, and W. Baehr. 1989. Cloning and
sequence analysis of the major outer membrane protein genes of two Chlamydia
psittaci strains. Infect. Immun. 57:1621-1625.
227. Zhao, Q., J. Schachter, and R. S. Stephens. 1993. Lack of allelic polymorphism for
the major outer membrane protein gene of the agent of guinea pig inclusion
conjunctivitis (Chlamydia psittaci). Infect. Immun. 61:3078-3080.
![Page 145: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/145.jpg)
140
First of all, I wish to express my sincere gratitude to my major academic supervisor,
Prof. Hideto Fukushi, Laboratory of Veterinary Microbiology, Faculty of Applied
Biological Sciences, Gifu University, for his solicitous and intellectual guidance during this
study. I am also deeply indebted to my co-supervisors, Dr. Tsuyoshi Yamaguchi,
Laboratory of Veterinary Microbiology, Gifu University and Prof. Shinagawa Kunihiro,
Department of Veterinary Microbiology, Faculty of Agriculture, Iwate University for their
pragmatic suggestions and supervision and also reviewing the manuscript.
I am also expressing my heartfelt thanks to Prof. Akira Matsumoto, Kawasaki
Medical School for his generosity in providing valuable biological materials for this study.
I am also thankfully acknowledging the treasured academic impetus provided by Prof.
Katsuya Hirai (retired) and Dr. Kenji Ohya, Laboratory of Veterinary Microbiology, Gifu
University during my stay in this laboratory.
I am sincerely grateful to Prof. Hishashi Inokuma, Obihiro University of
Agriculture, Prof. Eiichi Honda, Tokyo University of Agriculture and Technology and Prof.
Sekizaki Tsutomu, National Institute of Animal Health for their critical reviewing and
valuable suggestions during the preparation of this thesis.
I am also earnestly thankful to Dr. Karin D. Everett for her precious thoughts and
kind help in the analysis of genetic data during this study. I would also like to thank all the
veterinarians and field stall of different veterinary hospitals, bird parks, and zoos for their
kind help in sample collection.
I am also truly appreciative and very much grateful to all my fellow laboratory
students especially Dr. Pagamjav Ochir, Dr. Ando Masako, Dr. Yan Cai, Dr. Min Thin
Maw, Dr. Hirohito Ogawa and Dr. Souichi Yamada for their benevolent help in academic
and non-academic matters. Special thanks are also due to the non-academic staff of this
ACKNOWLEGDMENTS
![Page 146: Title Pathogenesis of Chlamydial Infections( 本文(FULLTEXT ...repository.lib.gifu-u.ac.jp/bitstream/20.500.12099/21409/...conjunctivitis in cats, particularly kittens (192). Studies](https://reader035.fdocument.pub/reader035/viewer/2022071215/60454c4e7dd56d61b85c1686/html5/thumbnails/146.jpg)
141
laboratory and the office of the United Graduate School of Veterinary Sciences for their
generous help.
I will always be indebted to Prof. R. C. Katoch and Dr. Madeep Sharma and all my
teachers and friends in India for making me worth to reach at this academic echelon.
I also express my sincere thanks to the Ministry of Education, Culture, Sports and
Science of Japan for the scholarship and financial support to my research in Japan. I am
also grateful to the authorities of CSK HP Agriculture University, Palampur for granting
me study leave and the Ministry of Human Resource Development, Government of India
for nominating me for this study.
The words cannot express the enduring and compassionate support of my wife
Praveen during some topsy-turvy moments in this period. I may not be able to compensate
the time that the twinkling little eyes of my son Shashwat have spent in waiting for his
father at home. The affectionate and ever reliable personal support of my brother Dr.
Rakesh Kumar Chahota and his family and Ashwani is cherished from heart.
Finally, I dedicate this thesis to my parents Sh. Jagdish Ram and Smt. Pushpa Rani
for their ever-lasting blessings that will always inspire me along with HIS ALMIGHTY.