daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI...
Transcript of daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI...
![Page 1: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/1.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
1 Annual Report 2011
daftar isicontents
Profil PerusahaanCompany Profile
Visi dan Misi PerusahaanCompany Vission and Mission
Kebijakan Mutu PerusahaanCompany Quality Policy
Sambutan KomisarisCommissioners Message
Sambutan Direktur UtamaPresident Director Message
Aktifitas ManajemenManagement Activities
Klasifikasi KapalShip Classification
Persetujuan GambarDrawing Approval
Aktifitas Survey KlasifikasiClassification Survey Activities
Aktivitas Jasa IndustriIndustrial Services Activities
Survey StatutoriaStatutory Survey
Otorisasi StatutoriaStatutory Authorization
Konsultasi & SupervisiConsultancy & Supervision
Penelitian & PengembanganResearch & Development
Pengembangan SDMHuman Resources Development
Teknologi InformasiInformation Technology
Tata Kelola Perusahaan Corporate Governance
Tanggung Jawab SosialSocial Responsibility
Kinerja KeuanganFinancial Performance
Komisaris, Direksi dan StafCommissioners, Director and Staff
Komite Konsultansi Klasifikasi Indonesia (K3I)The Consultative Committee of Indonesian Classification
KerjasamaCooperation
Jaringan OperasionalOperational Network
Daftar KontakList Of Contact
Laporan Auditor IndependenIndependent Auditors Report
![Page 2: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/2.jpg)
Annual Report 2011 Laporan Tahunan
2PT Biro Klasifikasi Indonesia (Persero)
Biro Klasifikasi Indonesia, juga dikenal sebagai BKI ada-lah Badan Usaha Milik Negara yang didirikan dengan tujuan mulia untuk mendukung kemandirian industri perkapalan dan pelayaran nasional melalui pelayanan jasa klasifikasi dan jasa-jasa lainnya yang terkait. BKI dalam pelayanan jasanya melakukan riset dan mem-publikasikan serta menerapkan standar teknik (Rules & Regulation) dengan melakukan kegiatan desain, konstruksi dan survey maritim terkait dengan fasili-tas terapung, termasuk kapal. Standar ini disusun dan dikeluarkan oleh BKI sebagai publikasi teknik. Rules & Regulation yang dikembangkan tidak hanya struktur konstruksi lambung, namun juga meliputi peralatan keselamatan, instalasi permesinan dan kelistrikan.
Lingkup kerja dari BKI adalah melaksanakan survey dan sertifikasi untuk menjamin bahwa Rules & Regu-lation yang telah dikembangkan, diterapkan pada saat pembangunan kapal baru dan kapal yang sudah jadi. Untuk mempertahankan kondisi kapal tersebut, maka dalam prosesnya kapal diharuskan melakukan perawa-tan dan perbaikan yang terjadwal, dimana pelaksanaan ini akan dimonitor terus oleh BKI dengan melakukan survey periodik dalam mempertahankan klasifikasinya.
Penilaian kondisi kapal dilakukan berdasarkan survey yang profesional dan independen oleh surveyor klasifi-kasi yang memiliki kompeten dalam melakukan penila-ian kondisi kapal. Hasil dari pemeriksaan dan penilaian ini berupa laporan dan sertifikat yang dijadikan acuan oleh pihak-pihak yang berkepentingan, antara lain Pe-
Biro Klasifikasi Indonesia, also known as BKI is a State Owned Company which was founded with the noble aim to support the independence of the shipping industry and the national shipping via the classification services and other services related. In the service, BKI researching, publishing and imple-menting technical standards (Rules & Regulations) by doing the design, construction and maritime sur-vey related to floating facilities, including ships. This standard is prepared and issued by BKI as technical publications. Rules & Regulations are not only devel-oped the structure of the hull construction, but also includes safety equipment, machinery and electrical installations.
The scope of work of BKI carries out the survey and certification to ensure that the Rules & Regulations have been developed and implemented during the construction of new ships and ships in service. To maintain the condition of the vessel, then in the pro-cess vessel is required to perform scheduled mainte-nance and repairs, where the implementation will be monitored closely by carry out periodic surveys to maintain its class.
The assessment of the condition of the vessel based on a survey conducted independently by professional and a competent surveyor in assessing the condi-tion of the vessel. The results of the examination and assessment are reports and certificates used as a reference by the parties concerned, including Ship’s
Profil PerusahaanCompany Profile
![Page 3: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/3.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
3 Annual Report 2011
milik Kapal, Pihak Asuransi, Pemilik Cargo, Pencharter, Galangan Kapal, Pemerintah / Syahbandar / PSC dll.
Kegiatan usaha pada awal berdirinya BKI adalah keg-iatan dalam bidang klasifikasi kapal (sebagai bisnis utama) dimana usaha ini dilaksanakan secara nirlaba, namun sejalan dengan perkembangan usaha, maka saat ini selain kegiatan di atas, juga melakukan diversifikasi usaha dengan mengembangkan kegiatan bidang jasa non klasifikasi, yaitu kegiatan usaha jasa konsultansi & supervisi. Sehingga saat ini kegiatan usaha BKI ada 2 (dua) kegiatan usaha, yaitu Kegiatan Usaha Jasa Klasi-fikasi & Statutoria dan Kegiatan Usaha Jasa Konsultansi & Supervisi.
Kegiatan Usaha Jasa Klasifikasi & Statutoria mencakup:• Pemeriksaan konstruksi kapal, pengawasan dan
pengujian serta penerbitan sertifikat kelas, registrasi kapal dan konstruksi lepas pantai.
• Pemeriksaan dan pengujian alat-alat apung danfasilitas konstruksi lepas pantai.
• Pengujiandansertifikasimaterialdankomponen.• Pengujiandanpenerbitansertifikatkualifikasijuru
las, inspektor las dan ahli las lainnya.• Melaksanakan pemeriksaan dan sertifikasi di bi-
dang statutoria berdasarkan otorisasi dari pemer-intah Republik Indonesia maupun dari pemerintah negara lain.
• Bertindak sebagai agen dan ataumewakili klasifi-kasi asing / konsultan asing.
• Melaksanakan sertifikasi sesuai standar interna-sional.
Sedangkan Kegiatan Usaha Jasa Konsultansi & Super-visi mencakup :• Jasakonsultansi&supervisidibidangmaritimdan
industri serta teknik lainnya.• Studikelayakandibidangteknologimaritimdanin-
dustri lainnya.• Jasa inspeksidan sertifikasidibidangminyak, gas
dan ketenagakerjaan.• Rekayasa teknik dan supervisi di bidang minyak
dan gas.• PengujianDTdanNDT.• Konsultansi sesuai standar nasional dan interna-
sional.
Owner, Insurance Party , Cargo Owner, charterer, Shipyard, Government / Harbour Master / PSC etc.
At the beginning,business activity of BKI is ship classification (as the main business) as a non-profit business, but in line with the growth of the business, today in addition to the above activities, as well as to diversify its business by developing non-class service sector activity, namely business consulting and su-pervision services. So, the current business activities in BKI there are 2 (two) business activities, the Busi-ness Classification & Statutory Services and Busi-ness Supervision &Consultancy Services.
Classification & Statutory Services includes :• Examination of ship construction, survey and
testing also issuance of class certificate and ship registration.
• Inspection and testing of floating facilities andoffshore construction facilities.
• Testingandcertificationofmaterialsandcompo-nents.
• Testingandcertificationofwelder’squalification,welding inspectors and other welding experts.
• Carryouttheinspectionandthecertificationinthe field of statutory based on the authorization of the Government of Republic of Indonesia and from other governments.
• Acting as an agent or representative of foreignclassification / foreign consultants.
• Carryoutthecertificationaccordingtointerna-tional standards.
Supervision & Consultancy Services includes:• Consultancyandsupervisionservicesinthemar-
itime and industrial fields as well as other techni-cal services.
• Feasibility study in themaritimefields technol-ogy and other industries.
• Inspection and certification services in the oil&gas and labor field.
• Engineeringandtechnical supervision in theoiland gas field.
• DTandNDTTesting.• Consultancyaccordingtonationalandinterna-
tional standards.
![Page 4: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/4.jpg)
Annual Report 2011 Laporan Tahunan
4PT Biro Klasifikasi Indonesia (Persero)
• Pelatihankeahliandibidangteknik.• Tankcleaning&sludgeprocessing.• Pencegahankorosi.
Setelah beroperasi selama 47 tahun, BKI telah mencapai keberhasilan dan kondisi sebagai berikut :• BerkantorpusatdiJakartadanmemiliki21kantor
cabang yang tersebar di seluruh Indonesia, termas-ukdi1(satu)cabangdiSingapore.
• Telahmemiliki kerja sama dengan hampir semuabadan klasifikasi asing anggota IACS.
• MenerbitkanRules&Regulationdibidangklasifi-kasi kapal dan setiap tahun menerbitkan Register Kapal dan Register ISM Code & ISPS Code
• Telahmendapatkanpelimpahantugas/wewenangdariPemerintahRepublik Indonesia cqDirektoratJenderalPerhubunganLautDepartemenPerhubun-gan untuk melaksanakan survey dan sertifikasi stat-utoria.
• TelahmendapatpenunjukaninspeksidansertifikasidariPemerintahcqDirektorat JenderalMigasdanDepartemenTenagaKerja.
• Telah menerapkan sistim manajemen mutu ber-dasarkan ISO9001 : 2008dan telahmendapatkansertifikatmutuISO9001 :2008daribadansertifi-kasi internasional.
• Telah menerapkan dan mendapatkan sertifikatSNI19-17020 (akreditasiperusahaan jasa inspeksiteknik) dan SNI 19-17025 (akreditasi laboratori-um).
• Trainingfortechnicalexpertise.• Tankcleaningandsludgeprocessing.• Preventionofcorrosion.
After operating for 47 years, BKI has achieved suc-cess and the following conditions:• Headquartered in Jakarta and has 21 branches
allaroundIndonesia,including1(one)branchinSingapore.
• HashadcooperationwithalmostalltheClassifi-cation members of IACS.
• IssuingRules&Regulationsofshipclassificationand annually publishes Ship Register and Regis-ter of ISM Code and ISPS Code
• BKIhasbeendelegatedbytheGovernmentoftheRepublic of Indonesia, cq Directorate General of Sea Transportation Ministry of Transportation to carry out the statutory survey and certification.
• Has received the designation of inspection andcertification from the Government cq the Direc-torate General of Oil and Gas and the Depart-ment of Labor.
• BKI has implemented a Quality ManagementSystembasedonISO9001:2008andhavegainedtheQualityCertificateISO9001:2008fromIn-ternational Agency.
• BKIhasbeenimplementedandcertifiedSNI19-17020 (accrediting technical inspection servicescompany)andSNI19-17025(laboratoryaccredi-tation).
![Page 5: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/5.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
5 Annual Report 2011
Annual Report 2010 Laporan Tahunan
![Page 6: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/6.jpg)
Annual Report 2011 Laporan Tahunan
6PT Biro Klasifikasi Indonesia (Persero)
Visi & Misi PerusahaanCompany Vision & Mission
Visi Perusahaan │ Company Vision
Menjadikan BKI sebagai perusahaan jasa teknik yang terpercaya dan terbaik dari segi kualitas produk, kualitas sumber daya manusia dan kinerja perusahaan.
Making BKI as a reliable service company and be the best at product quality, the best quality of human resources and corporate performance.
Misi Perusahaan │ Company Mission
• Mengutamakanterjaminnyakeselamatanjiwadanbendadilautsertaperlindunganlingkunganmelaluipengembangan dan pemeriksaan standar kapal serta fasilitas terkait lainnya.
• PengelolaanperusahaansecaraefektifdanefisiendenganmenerapkanTataKelolaPerusahandenganBaik.• MembentukcitraperusahaanbahwajasaBKIdibutuhkandanmenjadistandarkeselamatandankualitas.• Memberikankesempatankepadaparatenagaahlikelautannasionaluntukberpartisipasimelaluipengem-
bangan pengetahuan serta penerapannya.• MembantupeningkatanpendapatannegarabaikdalambentukRupiahmaupunvalutaasing.
• Giveprioritytoensuringsafetyofthepeopleandobjectsintheseaandenvironmentalprotectionthroughthedevelopment and examination of ships standard and other related facilities.
• ManagethecompanieseffectivelyandefficientlybyapplyingtheGoodCorporateGovernance.• EstablishacorporateimagethatBKIservicesareneededandbecomeastandardofsafetyandquality.• Provideanopportunityfornationwidemarineexpertstoparticipatethroughthedevelopmentofknowledge
and its application.• HelpstoincreaserevenuesintheformofRupiahsandforeigncurrencies.
![Page 7: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/7.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
7 Annual Report 2011
Annual Report 2011 Laporan Tahunan
![Page 8: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/8.jpg)
Annual Report 2011 Laporan Tahunan
8PT Biro Klasifikasi Indonesia (Persero)
Sebagai perusahaan yang menerapkan sistem manajemen mutuberdasarkanISO9001:2008,BKImemilikikomit-men untuk memberikan kepuasan kepada pemakai jasa (customer satisfaction) dan terus melakukan penyem-purnaan (continuous improvement). Kebijakan Mutu Perusahaan adalah "mengutamakan pelayanan jasa bagi para pengguna jasa berdasarkan kepedulian yang tinggi terhadap masalah Keselamatan dan Mutu".
Dalammewujudkankomitmen tersebut,BKI memilikiNilai - nilai Perusahaan yang diterapkan pada seluruh ja-jaran organisasi, meliputi : • Motoperusahaan"TERPERCAYA",yangberartijasa
yang diberikan adalah berkualitas, dapat diandalkan, efisien, tepat waktu dan memiliki reputasi.
• Nilai-nilaiperusahaanyaituIntegritas,Profesional-isme, Kepuasan Pengguna Jasa, Kepemimpinan dan Penghargaan pada Karya / Prestasi Karyawan.
• BudayaPerusahaan"TERTIB"(TaqwakepadaTuhanYME;Etoskerjayangtinggi;Reputasiyangsenantia-saditingkatkan;Tertibdalammenerapkankebijakanmanajemendansikappribadi;IlmupengetahuandanTeknologiyangdikuasai;Baikdalampelayanandanhasil kerja).
Manajemen BKI menjamin :• Persyaratanmutuberorientasi kepada standarmutu
Internasional sesuai dengan ISO 9001:2008 danpemenuhan pencapaian sasaran mutu perusahaan serta senantiasa melakukan penyempurnaan yang menerus terhadap mutu.
As company that implement quality management systemsbasedonISO9001:2008,BKIhasacommit-ment to give satisfaction to the user (customer satis-faction) and continue to make improvements (con-tinuous improvement). Company Quality Policy is a "Priority of service for users based on high concern to the Safety and Quality".
In realizing these commitments, BKI has the Com-pany’s Value are applied throughout the organiza-tion, including:• Themotto of the company is "TERPERCAYA /
RELIABLE",whichmeanstheserviceprovidedishighquality,reliable,efficient,timelyandreputa-ble.
• The value of the company are : Integrity, Pro-fessionalism, Service User Satisfaction, and Leadership,andEmployeeAchievement.
• CorporateCulture"TERTIB"(TaqwatoGodAl-mighty; high work ethic; enhanced of reputation; Orders in implementing management policies and personal attitudes; Science and Technology held; Good in service and result of work).
BKI management ensures:• Qualityrequirementsorientedtotheinternation-
alqualitystandardISO9001:2008inthefulfill-mentoftheachievementofthequalityobjectivesof the company and make continuous improve-ments of quality.
Kebijakan Mutu PerusahaanCompany Quality Policy
![Page 9: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/9.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
9 Annual Report 2011
• Penerapan Sistem Mutu dan nilai-nilai perusahaantersebut dalam seluruh kegiatan jasa.
• Tanggap terhadap kebutuhan pemakai jasa /masyarakat umum dan mengutamakan kepuasan pel-anggan dan aspek keselamatan.
• Semuapersonilselaludiberipemahamantentangsis-tem mutu melalui pelatihan yang berkesinambungan serta penerapan sistem mutu di dalam semua jajaran organisasi.
Pemenuhan terhadap kebijakan, prosedur dan petunjuk kerja adalah hal yang mutlak dan mengikat bagi semua karyawan. Mutu adalah tanggung jawab semua karyawan yang bekerja di jajaran BKI.
• ImplementationofQualitySystemandthecom-pany values in all service activities.
• Responsivenesstotheneedsofusers/publicandcustomer satisfaction and safety aspect.
• Allpersonnelarealwaysgivenanunderstandingof the quality system through continuous train-ing and implementation of quality systems in all ranks of the organization.
Compliance to the policies, procedures and work instructions is an absolute and binding for all em-ployees. Quality is the responsibility of all employees working in the ranks of BKI.
![Page 10: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/10.jpg)
Annual Report 2011 Laporan Tahunan
10PT Biro Klasifikasi Indonesia (Persero)
Annual Report 2011 Laporan Tahunan
![Page 11: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/11.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
11 Annual Report 2011
Assalamu'alaikum Warohmatullohi Wabarokatuh
Para Pemangku Kepentingan PT. Biro Klasifikasi Indone-sia yang terhormat,Secara umum perekonomian Indonesia mencatat perkembangan yang cukup baik, bahkan Pemerintah menilai kinerja perekonomian pada 2011 merupakanterbaiksetelahkrisis1998meskipunmenjelangakhirta-hundibayangiolehkrisisperekonomiandiEropa.Haliniditandai dari realisasi inflasi hanya 3,79% dan pertumbu-hanekonomiyangmenembus6,5%yangdidukungolehkonsumsi domestik dan investasi, yang tentunya dihasil-kan dari arus barang dan modal antar pulau maupun antar negara melalui perdagangan internasional.
Kondisi tersebut di atas mendorong PT. Biro Klasifikasi Indonesia(Persero)padatahun2011berhasilmembuku-kanpendapatansebesarRp334milyarataunaik18%daritahun sebelumnya, dan laba (rugi) komprehensif sebe-sar Rp 51milyar atau naik 41% dari tahun sebelumnya.Pencapaian ini mencerminkan kinerja pelayanan untuk menjaga kepercayaan pelanggan dapat terus terjaga setiap tahunnya. Secara umum, target kinerja yang ditetapkan PemegangSahamuntuktahun2011sebagianbesardapattercapai dan jumlah kontribusi pajak dan dividen mening-kat kepada Negara serta tanggung jawab sosial perusahaan kepada lingkungan sekitar dapat terlaksana dengan baik. Hasil audit laporan keuangan oleh Kantor Akuntan Publik Kanaka Puradiredja, Suhartono menyatakan wajar dalam semua hal yang material dan tingkat kesehatan perusahaan "AAA" sesuai indikator penilaian kesehatan BUMN.
Assalamu'alaikum Warohmatullohi Wabarokatuh
Stakeholders of PT. Biro Klasifikasi Indonesia and gentlemen,In general, Indonesia's economy developed quite a good record, even the Government assess the eco-nomicperformancein2011isthebestafterthe1998crisis, although towards the end of the year was over-shadowedbytheeconomiccrisisinEurope.Itischar-acterized from only 3.79% inflation and economic growththroughthe6.5%,supportedbydomesticcon-sumption and investment, which certainly result from the flow of goods and capital across the island and across the country through international trade.
The conditions mentioned above encourage PT. Biro KlasifikasiIndonesiain2011successfullypostedreve-nueofRp334billionoranincrease18%fromthepre-viousyear,andearnings(loss)comprehensiveofRp51billionoranincreaseof41%fromthepreviousyear.This achievement reflects the service performance to maintain customers trust each year. In general, the performance targets set for 2011 Shareholders canlargely be achieved and the amount of contributions tax and dividend increases to the State as well as cor-porate social responsibility to the neighborhood can be done well. The audit results of financial statements by PublicAccountantOfficePuradiredjaKanaka,Suhar-tono state fair in all material respects and the health of the company is "AAA" according to State Owned Enterprise(SOE)healthassessmentindicators.
Sambutan Dewan KomisarisBoard of Commissioners Message
![Page 12: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/12.jpg)
Annual Report 2011 Laporan Tahunan
12PT Biro Klasifikasi Indonesia (Persero)
Kinerja tersebut di atas tidaklah untuk membuat insan jajaran perusahaan cepat berpuas diri. Sebagai penyedia layanan jasa klasifikasi dan jasa teknik terkait, PT. Biro Klasifikasi Indonesia (Persero) berupaya lebih menin-gkatkan profesionalisme dan integritasnya untuk mem-berikan pelayanan jasa prima, terpercaya dan beretika. Perusahaan juga perlu terus melanjutkan kiprah aktifnya dalam sidang IMO dan semakin mensejajarkan dirinya dengan klasifikasi asing lainnya di Asia melalui forum ACS (Asian Classification Societies) ExecutiveMeetinguntuk belajar dan meningkatkan kompetensi dan ka-pasitasnya. Dalam bidang konsultansi & supervisi, pe-rusahaan juga tetap memperkuat eksistensinya dengan meraih pasar dari kebutuhan jasa industri swasta dan memperlengkapi infrastruktur serta kompetensi SDMuntuk meningkatkan layanan kepada pengguna jasa.
Secaraumum,DewanKomisarisbersama-samadenganDireksiakanmenekankanpentingnyamenjagapertum-buhan nilai perusahaan secara jangka panjang. Perusa-haan perlu mengimbangi kegiatan perusahaan dengan upaya pengembangan melalui investasi pada sumber daya manusia, kegiatan riset dan pengembangan, mem-perkuat database perusahaan serta pemenuhan mutu lay-anan yang berorientasi pada standar mutu internasional. Demikianjuga,pemanfaatanITuntukinovasipelayanandan peningkatan efektivitas dan efisiensi operasional harus terus dilanjutkan.
Seluruh pencapaian perusahaan di tahun 2011 dapatdiraih atas rahmat dan karuniaNya semata, oleh karena ituDewanKomisarismemanjatkanrasasyukurkehad-iratTuhanYangMahaEsa.Kepada jajaranDireksi danstaf yang mampu mempersembahkan kinerja perusahaan yangbaik sesuai dengan visi danmisi perusahaan,De-wan Komisaris juga menyampaikan rasa terima kasih danapresiasi yang tinggi.Demikian jugakepada stake-holders atas kepercayaannya kepada perusahaan, Pemeg-ang Saham yang senantiasa memberikan saran dan arah pengelolaan perusahaan serta kepada Komite Audit yang telahbekerja samadalamupayapelaksanaan tugasDe-wan Komisaris.
SemogaTuhanYangMahaEsamembimbingkitadalammelanjutkan kesuksesan PT. Biro Klasifikasi Indone-
Performance mentioned above is not to make a quick company ranks human complacency. As a provider of classification services and related engineering ser-vices, PT. Biro Klasifikasi Indonesia seeks further enhance the professionalism and integrity to deliver execellent services, reliable and ethical. The company also needs to continue its active pursuit in IMO as-sembly and align itself with the other foreign classi-fication in Asia through a forum ACS (Asian Clas-sification Societies) ExecutiveMeeting to learn andimprove their competence and capacity. Within field of consultancy and supervision, the company also continued to strengthen its presence in the market reach of the service needs of private industry and equipping of infrastructure and human resource com-petencies to improve service to service users.
In general, the Board of Commissioners together with the Board of Directors will emphasize the importance of maintaining growth in the long term corporate value. Companies need to offset the company's activi-ties with development efforts through investment in human resources, research and development activi-ties, strengthening the company's database as well as the fulfillment of quality oriented services of interna-tional quality standards. As well the utilization of IT for innovation and improved service effectiveness and efficiencyofoperationsshouldbecontinued.
Thewholecompany'sachievementsin2011canonlybe achieved by His mercy and grace alone, therefore, the Board of Commissioners offer gratitude to the presence of Almighty God. To the Board of Directors and staff who able to present a good corporate perfor-mance in accordance with the vision and mission, the Board of Commissioners also expressed our thanks and high appreciation. As well to the company's shareholders for thrustiness who continues to provide advice and direction of the management company and to the Audit Committee who have worked to-gether in efforts to implement the task of the Board of Commisioners.
May God the Almighty guide us in the continuing success of PT. Biro Klasifikasi Indonesia in the future
![Page 13: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/13.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
13 Annual Report 2011
sia (Persero) di masa mendatang serta secara konsisten mampu menerapkan prinsip-prinsip Good Corporate Governance.
and consistently able to apply the principles of Good Corporate Governance.
a.n.DewanKomisarisPTBiroKlasifikasiIndonesiaKomisaris Utama
On behalf of the Board of Commissioners of PT. Biro Klasifikasi IndonesiaPresident Commissioner
Capt. Drs. Abdul Gani, MM, MBA
![Page 14: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/14.jpg)
Annual Report 2011 Laporan Tahunan
14PT Biro Klasifikasi Indonesia (Persero)
Profil Dewan KomisarisCommissioners Profile
SusunanDewanKomisarisberdasarkanKeputusanMenteriBUMNNo.KEP.155/MBU/2009tanggal28Juli2009, adalah sebagai berikut :1. KomisarisUtama: Capt. Drs. Abdul Gani, MM, MBA2. Komisaris : Drs. Riyadi Widiasmoro, MSi3. Komisaris : Liliek Mayasari, SE
Board of Commissioners based on Keputusan MenteriBUMNNo.KEP.155/MBU/2009onJuly28,2009, are as follows:1. PresidentCommissioner: Capt. Drs. Abdul Gani, MM, MBA2. Commissioner : Drs. Riyadi Widiasmoro, MSi3. Commissioner : Liliek Mayasari, SE
213
![Page 15: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/15.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
15 Annual Report 2011
Capt. Drs. Abdul Gani, MM, MBA
Drs. Riyadi Widiasmoro, MSi
Liliek Mayasari, SE
KomisarisUtama;Usia61tahun,Pendidikan:AkademiIlmuPelayaran(1974),MualimIPe-layaranBesar/ANT.I(1980),MarineInspectorA(1985),KesyahbandaranKelasI(1986),PortStateControl(1996),InternationalSafetyManagement(1997),STIALANRI/Strata1(1997),AIMS(ADM)/Strata2(2000).Pengalaman:Mualims/dNakhodakapalniaga(1974–1982);DepartemenPerhubungan(1983–2009),antaralaindiAdpelKelasISorong(2002–2004),AdpelUtamaMakassar (2004 – 2007),Direktur Perkapalan danKepelautan (2007 – 2009);ProjectManagerPenyusunanStandarKapalNonKonveksi(NCVS)Indonesia(2009);LiasionOfficerpadaProjectNCVSIndonesia(2009–sekarang).
Komisaris;Usia60tahun;Pendidikan:STIALANRI(1978),UniversitasIndonesia/MagisterSains(1995).Pengalaman:DepartemenKeuangan(1972),DosenSTIALANRI(1995–seka-rang),DirekturOperasiPT.KliringBerjangkaIndonesia(2000–2002),DirekturPerencanaan&PengembanganPT.BhandaGharaReksa(2002–2009).
Komisaris; Usia 41 tahun; Pendidikan : Fakultas Ekonomi Universitas GajahMada (1994).Pengalaman:DitjenPembinaanBUMN,DepartemenKeuangan(1996–1998),KementerianBUMN(1998–sekarang).
PresidentCommissioner;61yearsold,Education:PilotageAcademy(1974),OceanGoingShip-ping 1stNavigator /ANT. I (1980),Marine InspectorA (1985), First ClassKesyahbandaran(1986),PortStateControl(1996), InternationalSafetyManagement(1997),STIALANRI/S1(1997),AIMS(ADM)/S2(2000).ExperienceMerchantShipChiefOfficer-Master(1974-1982);DepartmentofTransportation(1983-2009),amongothersinAdpelClassISorong(2002-2004),AdpelMakassar(2004-2007),DirectorofShippingandSeaFearer(2007-2009);ProjectManager preparation of Non Convention Vessel Standard (NCVS) Indonesia (2009); Liasion Of-ficeratNCVSIndonesiaProject(2009-present).
Commissioner;60yearsold;Education:STIALANRI(1978),UniversityofIndonesia/MasterofScience(1995).Experience:MinistryofFinance(1972),LecturerofSTIALANRI(1995-present),DirectorofOperationsPT.KliringBerjangka Indonesia (2000 -2002),DirectorofPlanning&Development PT. Bhanda Ghara Reksa (2002 - 2009)
Commissioner;41yearsold;Education:MasterofEconomy,GajahMadaUniversity(1994).Ex-perience:CoachingforState-ownerCorporationsEnterprises,MinistryofFinance(1996-1998),StateMinisterforState-ownerCorporation(1998-present).
![Page 16: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/16.jpg)
Annual Report 2011 Laporan Tahunan
16PT Biro Klasifikasi Indonesia (Persero)
Annual Report 2011 Laporan Tahunan
![Page 17: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/17.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
17 Annual Report 2011
Awali perbuatan baik dengan niat baik sehingga ke-inginan mewujudkan hari ini menjadi lebih baik dari kemarin dan hari esok lebih baik dari hari ini bisa ter-wujud. Itulah kata-kata bijak yang memotivasi kami dan seluruh karyawan untuk terus memberikan yang terbaik bagi BKI serta bagi para pemakai jasa dan selu-ruh pemangku kepentingan.
Sudah selayaknya kita memanjatkan puji dan syukur kehadiratTuhanYangMahaEsa,karenadalamtahun2011inibanyakhalbaikyangberhasildiraihdandiwu-judkanolehBKI.InpresNomor5Tahun2005tentangPemberdayaan Industri Pelayaran Nasional dan Un-dang-undang PelayaranNomor 17 Tahun 2008 yangkemudian diikuti dengan Peraturan Pemerintah No-mor22Tahun2011yangmenegaskanpemberlakuanazas cabotage di Indonesia telah memberikan doron-gan dan kekuatan bagi bangkitnya dunia pelayaran dan industri perkapalan nasional. Sejalan dengan hal terse-but, Register BKI membukukan adanya pertumbuhan positif jumlah kapal yang diklaskan sepanjang 2011.Hasil ini tentunya tidak lepas dari upaya konsisten BKI untuk membangun dan menjaga kepercayaan para pemakai jasa dan pemangku kepentingan, terutama kalangan asuransi, para pemilik dan operator kapal, serta instansi pemerintah terkait. Kepercayaan yang semakin baik itu harus terus dijaga karena merupakan modal terpenting dalam membangun reputasi sebuah badan klasifikasi. Upaya kami menjaga kepercayaan itu adalah dengan selalu menjaga kualitas cara dan hasil kerja, meningkatkan kecepatan pelayanan, mening-
Start the good deeds with the good intentions that embody the desire that today better than yesterday and tomorrow better than today could be realized. That's the wise words which motivate us and our em-ployees to continue to provide the best for BKI, share-holder and stakeholder.
It’s a must that we have to prayed and thanked to LordAlmighty,becauseinthe2011wasalotofgoodthings that we achieved and realized . Presidential InstructionNo.5-2005regardingNationalSailingIndustryEmpowermentandAdmiraltyLawNo. 17- 2008whichwasfollowedbyGovernmentRegula-tionNo.22-2011whichconfirmedtheapplicationof the principle of cabotage in Indonesia had given impetus and strength to the rise of shipping bussin-ness and shipbuilding industries nationwide. In line with this, the Register BKI posted a positive growth of numberof the ships classed throughout2011.Theseresults are certainly not out of BKI consistent effort to build and maintain the confidence of users and stakeholders, especially among insurers, ship owners and operators, as well as related government agen-cies.The trust must be maintained as it is the most important asset in the building of reputation of an entity of classification body. Our efforts to maintain the trust is always maintain the quality of the way and the work, increase the speed of service, improve the competence and capabilities of human resources, andimproveoperationalefficiencyandeffectiveness
Sambutan Direktur UtamaMessage from President Director
![Page 18: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/18.jpg)
Annual Report 2011 Laporan Tahunan
18PT Biro Klasifikasi Indonesia (Persero)
katkan kompetensi dan kapabilitas SDM, sertamen-ingkatkan efisiensi dan efektivitas operasional melalui penerapan sistem berbasis teknologi informasi.
Dalamtahun2011inikamimencatatbeberapahalsig-nifikan baik eksternal maupun internal yang dilakukan BKI.Dalam kancah internasional, BKImemantapkaneksistensi dan peranannya dalam forum Asian Clas-sification Societies Executive (ACS) Meeting dengansecara konsisten mendukung dan berpartisipasi dalam kegiatan Technical Management Group ACS. BKI juga menghadiriforumpertemuanAseanShipbuildingEx-pertForum(ASEF)danseminaryangdiselenggarakanKorean International Cooperation Agency (KOICA) yang diadakan di Korea Selatan. Dalam kesempatanlain BKI juga bergabung dalam delegasi pemerintah RI menghadiriSidangDewanInternationalMaritimeOr-ganization (IMO) untuk mendukung pencalonan kem-baliIndonesiasebagaianggotaDewanIMOKategoriC.
Kerjasama dengan class partner American Bureau of Shipping dan Nippon Kaiji Kyokai juga memasuki ba-bak baru terkait dengan proyek prestisius pembangu-nankapalFloatingLNGPlanandStorageInpexMase-la. DengandukunganpenuhBPMigasBKIdimintauntuk bermitra dengan ABS dalam melakukan kajian Front End Engineering Design FLNG Inpex Maselatersebut. Hal ini tentu saja menjadi nilai tambah bagi kemajuan dan reputasi BKI karena pihak pemerintah RI melalui BP Migas memberikan dorongan dan ke-percayaan kepada badan klasifikasi nasional untuk ter-libat dalam proyek berteknologi tinggi yang menjadi incaran badan-badan klasifikasi ternama dunia.
Dalam lingkup nasional BKI menandatangani NotaKesepahaman dengan Badan Pemeriksa Keuangan untuk pengembangan sistemE-Audit, dengan BadanPengkajian Penerapan Teknologi untuk pengem-bangan kerjasama penelitian proses dan material kapal fiberglass,denganBadanPengembanganSumberDayaManusia Perhubungan untuk pengembangan kerjasa-mapemanfaatanfasilitasdanSDM,dandenganTUVRheinland Indonesia yang merupakan bagian dari lem-baga pemeriksa dan sertifikasi terkemuka dari Jerman untuk pengembangan kerjasama pemeriksaan dan ser-tifikasi produk-produk import.
through the application of information technology-based systems.
In2011werecordedsomesignificantexternalandin-ternal committed by BKI. In the international arena, BKI established the existence and role in the Asian fo-rumExecutiveClassificationSocieties(ACS)Meetingwith consistently supported and participated in the Technical Management Group ACS. BKI also attend-edthemeetingofASEANShipbuildingExpertForum(ASEF)andaworkshoporganizedbyKoreanInter-national Cooperation Agency (KOICA) held in South Korea.OnanotheroccasionBKIalsojoinedthegov-ernment delegation to attend the Board Meeting of the International Maritime Organization (IMO) to support the come back of Indonesia as a member of the IMO Council Category C.
Cooperation with the class partner American Bureau ofShippingandNipponKaijiKyokaialsoenteredanew phase of development associated with prestig-iousprojectsFloatingLNGshipsandStorage InpexMasela. With the full support of BP Migas, BKI asked topartnerwithABSinreviewingtheFrontEndEngi-neering Design FLNG Inpex Masela. This is of course an added value for the progress and reputation BKI because the government of Indonesia through the BP Migas gives encouragement and confidence to the national classification bodies to engage in high-tech project that became the target of world-renownedclassification bodies.
In the national scope BKI signed MOU with BPKP for the development of E-Audit,with BPPT for thedevelopment of cooperative research processes and materials of fiberglass boat, with Human Resources Development - Ministry of Transportation for the developmentofjointuseoffacilitiesandhumanre-sources, and with TUV Rheinland Indonesia, which is part of the inspection and certification agencies from Germany leading to the development of co-operation inspection and certification of imported products.
![Page 19: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/19.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
19 Annual Report 2011
Berkaitan dengan sinergi antar BUMN, BKI juga mengembangkan sinergi dengan PT. PANN (Persero) danPT.ASDPIndonesiaFerry(Persero)untuksuper-visi perawatan armada kapal kedua perusahaan tersebut.
Di lingkup internalbidangpengembanganorganisasidanSDMBKImelakukanpenyempurnaansistemope-rasi berbasis Teknologi Informasi yang mengintegrasi-kanClassificationOperationSystem(CopS),FinancialOperation System (FinOpS), danConsultancy& Su-pervision Operation Systen (CSOpS) ke dalam sistem on line yang terpadu untuk meningkatkan efisiensi dan efektifitas mekanisme input, proses, dan output seka-ligus meningkatkan aspek monitoring serta ketepatan dan kecepatan pelaporan. Program pembinaan dan peningkatan kompetensi SDM dilakukan antara lainmelalui penyelenggaraan in-house training, refreshing dan up grading course terpadu bagi para Surveyor dan Inspektor, serta mengirimkan kader-kader BKI untuk tugas belajar mengambil program pasca sarjana di ITS Surabaya, World Maritime University di Malmo, Swed-ia, Osaka University Jepang, serta mengikuti training-training pendek di kantor pusat Nippon Kaiji Kyokai di Tokyo, Jepang.
Sebagaimana telah disinggung di atas, pada bidang usaha klasifikasi, jumlah kapal dengan klas berlaku yang tercatat dalam Register kapal BKI pada akhir tahun 2011 sebanyak 7.528 unit dengan total tonase11.948.154GT,meningkat dibandingkan tahun 2010yangberjumlah6.400unitdan9.594.091GT.
Kondisisosialdanperekonomiannasionalselama2011yang relatif stabil dan kondusif menjadikan BKI mam-pu mempertahankan kinerja usahanya. Realisasi pen-dapatankotormeningkatdariRp282,23milyarpadatahun2010menjadiRp335,12milyar,yangberasaldarikontribusibidangusahaklasifikasi sebesarRp215,27milyar yang meningkat 19,57 persen dibandingkantahun sebelumnya dan bidang usaha Konsultansi dan Supervisi sebesar Rp 119,85 milyar yang meningkat17,28persen.UntukrealisasilabasetelahPPhBadan,BKI berhasil membukukan angka sebesari Rp 51,28milyar atau di atas tahun sebelumnya yang berjumlah Rp 36,22 milyar.
Related to the synergies among BUMN, BKI also de-velops synergies with PT. PANN (Persero) and PT. ASDP Indonesia Ferry (Persero) for fleet mainte-nance supervision of the two companies.
Internally, Organizational Development and HR BKI make improvements based on IT operating sys-tem that integrates Operation Classification Sys-tem (Cops), Financial Operation System (FinOpS), and Consultancy & Supervision Operation Systen (CSOpS) into an integrated system on line to improve efficiency and effectiveness of themechanismof in-put, process, and output while improving aspects of monitoring and the speed and accuracy of reporting . Development and improvement program of HR com-petencies conducted by in-house training, refreshing and an integrated up grading course for the Survey-ors and Inspectors, as well as personnel sent to the task of learning to take graduate courses at ITS Sura-baya, World Maritime University in Malmo - Swe-den, Japan Osaka University, and follow the shorttrainings in Nippon Kaiji Kyokai headquarters inTokyo-Japan.
As has mentioned above, in the classification bussin-ness, the number of ships with the valid class regis-teredintheRegisterBKIattheendof2011is7528unitswithatotal tonnageof11,948,154GT,anin-creasecomparedfrom2010whichamountedto6400unitsand9,594,091GT.
Social conditions and the national economy during 2011isrelativelystableandconducivetomakingBKIable to maintain its performance. Realization of gross revenuesincreasedfromRp282.23billionin2010toRp335.12billion ,which comes from the contribu-tionofthebusinessclassificationRp215.27billion,increasing19.57percentover thepreviousyearandfrom the business Consultancy and Supervision Rp 119.85billion,increasing17.28percent.Forthereali-zation of profit after income tax agency (PPh Badan), BKI managed Rp 51.28 billion over the previousyear, amounting to Rp 36.22 billion.
![Page 20: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/20.jpg)
Annual Report 2011 Laporan Tahunan
20PT Biro Klasifikasi Indonesia (Persero)
Berdasarkan standard penilaian Kementerian BUMN dan hasil audit Kantor Akuntan Publik, BKI kembali dapat mempertahankan tingkat kinerja manajemen “Sehat AAA”. Keberhasilan ini tidak terlepas dari an-gkaNetReturnonEquity (NetROE)yangmencapai41,58persendanReturnonAsset(ROA)yangmenca-pai31,58persen.Biladibandingkansukubungarata-rata bank yang berlaku pada akhir 2011 sebesar 6-7persen per tahun, maka angka-angka ini menunjukkan kinerja manajemen dalam memaksimalkan keuntun-gan untuk pemegang saham atau terhadap total asset dapat dikategorikan cukup baik.
Mencermati segala yang berhasil kita raih, sudah sepantasnyalah kita mengucap syukur ke hadirat Tu-hanYangMahaEsaatassegalarahmat,kasih-sayang,pentunjuk, lindungan, dan ridho-Nya sehingga BKI dapat merealisasikan Rencana Kerja dan Anggaran Pe-rusahaan2011denganhasilyangbaik.
MewakiliDireksidansegenapjajaranBKIkamiinginmenyampaikan penghargaan dan terima kasih kepada Menteri Negara BUMN c.q. Deputi Menteri BidangUsaha Jasa beserta jajarannya serta kepada Menteri Perhubungan c.q. Dirjen Perhubungan Laut besertajajarannya atas segala bantuan, dukungan, dan arahan yang diberikan.
Penghargaan dan terima kasih kami sampaikan pula kepada Dewan Komisaris yang telah memberikanmasukan, arahan, dan koreksi serta peranannya seba-gai mitra kerja yang konstruktif sehingga Perusahaan dapat merealisasikan program kerjanya dan memberi-kan kontribusi positif kepada bangsa dan negara.
Kepada seluruh karyawan dan karyawati BKI baik di KantorPusatmaupunKantorCabang,Direksimeny-ampaikan terima kasih dan penghargaan atas segala sumbangsih, dedikasi, dan produktivitas yang telah diberikan dalam ikut mensukseskan realisasi program kerjaPerusahaanditahun2011.
Mengakhiri pesan ini, kami juga ingin mengucapkan terima kasih dan penghargaan kepada para pemangku kepentingan atas segala kepercayaan, dukungan, ban-
Based on the standard assessment of the Ministry of BUMN and audit of Public Accounting Firm, BKI back to maintain the level of performance manage-ment "Sehat AAA". The success rate is including the Net Return on Equity (ROE Net), which reached41.58 percent and Return on Assets (ROA), whichreached31.58percent.Whencomparedtotheaver-ageinterestrateapplicablebankin late2011of6-7percent per year, these figures demonstrate the per-formance of management in maximizing profits for shareholders or to total assets can be considered quite good.
Looking at all the success we achieve, we have to thankful to the Lord Almighty, for all the grace, com-passion, directions, protection, and His blessing so that BKI can realize the good Corporate Work Plan andBudget2011.
On behalf of Board of Directors and all staff, we would like to express our appreciation and gratitude totheStateOwnedEnterprisesMinistercq.DeputyMinister of State Business Services and the staff, to the Transportation Minister cq. Director General of Sea Transportation and the staff for all their help, support, and referrals provided.
Our appreciation and thanks also to convey to the Board of Commissioners who have provided input, guidance, and correction as well as its role as a con-structive partner so that the company can realize its work program and make a positive contribution to the nation and state.
ToallBKIemployeeinHeadOfficeandBranchOf-fices, Directors expressed thanks and appreciation for all the contributions, dedication, and productiv-ity that have been granted in part the success of the realizationoftheCompany'sworkprogramin2011.
An end to these messages, we want to thank you and appreciation to the stakeholders for all the confi-
![Page 21: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/21.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
21 Annual Report 2011
tuan, dan partisipasinya dalam ikut memberdayakan dan memajukan BKI.
SemogaTuhanYangMahaEsameridhoiniatbaikdanusaha kita.
dence, support, assistance, and participation in part to empower and advance the BKI.
May Lord Almighty bless our good intentions and ef-forts.
A.n.DireksiDirekturUtama
On Behalf of Board of DirectorsPresident Director
Capt. Purnama, MM
![Page 22: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/22.jpg)
Annual Report 2011 Laporan Tahunan
22PT Biro Klasifikasi Indonesia (Persero)
Profil DireksiBoard of Directors Profile
2134
1.Purnama Sembiring Meliala(DirekturUtama/President Director)2. Edy Cahyono(DirekturKeuangandanPersonalia/Director of Finance and Personnel)3. Ajatiman(DirekturTeknikdanPengembangan/Director of Technical and Development)4. Setudju Dangkeng(DirekturOperasidanPemasaran/Director of Operations and Marketing)
![Page 23: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/23.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
23 Annual Report 2011
Purnama Sembiring Meliala
Edy Cahyono
Ajatiman
Setudju Dangkeng
Usia56tahunmenjabatsebagaiDirekturUtamaPT.BiroKlasifikasiIndonesiasejaktanggal8Desember2010.Beliau memulai karirnya di PT. Samudera Indonesia Tbk dan kemudian sebagai pegawai di Kementerian Per-hubungan. Jabatan yang beliau emban sebelumnya antara lain pada periode 2007 - 2009 sebagai Kepala Sub DirektoratPemanduandanPenundaanKapalpadaDirektorat JenderalPerhubunganLautdanpadaperiode2009-2010menjabatsebagaiAdministratorPelabuhanTelukBayur,Padang.BeliaumeraihgelarSarjanabidangNautika di Lembaga Pendidikan Tinggi Maritim Jakarta dan meraih gelar Master Manajemen di bidang pemasa-ranpadaInstitutPengembanganKewirausahaanIndonesia(1997).
Usia43tahunmenjabatsebagaiDirekturKeuangandanPersonaliaPT.BiroKlasifikasiIndonesiasejaktanggal8Desember2010.BeliaumemulaikarirnyasebagaiAhliGeologidiPT.KaltimPrimaCoal(1994-1995)dankemudiansebagaipegawaidiDirektoratJenderalBUMNDepartemenKeuangan(2001-2002). Jabatanyangbeliau emban sebelumnya antara lain sebagai Kepala Bidang Restrukturisasi dan Privatisasi Usaha Perbankan dan Jasa Keuangan (2002 - 2006), Kepala Bidang Restrukturisasi dan Privatisasi Jasa Logistik dan Pariwisata (2008-2010).BeliaumeraihgelarSarjanaTeknikGeologidariUniversitasGajahMada,YogyakartadanMasterof Science dari Universitas Indonesia.
Usia58tahunmenjabatsebagaiDirekturTeknikdanPengembanganPT.BiroKlasifikasiIndonesiasejaktanggal8Desember2010.BeliaumemulaikarirnyadiBKIsejaktahun1980dantelahmendudukijabatandiberbagaiposisi,antaralainKepalaCabangCirebon(1984-1987),KepalaSeksiKlasifikasidanSertifikasi,DivisiSurvey(1991-1993),KepalaSeksiPelaporandanSertifikasi,DivisiSurvey(1993-1997),KepalaDivisiSurvey(1997-2000),KepalaSatuanPerencanaan(2000-2003),KepalaUnitKonsultansi&Supervisi(2007-2010).BeliaumeraihgelarSarjanaTeknikPerkapalandariInstitutTeknologi10Nopember,Surabaya.
Usia57tahunmenjabatsebagaiDirekturOperasidanPemasaranPT.BiroKlasifikasiIndonesiasejaktanggal8Desember2010.BeliaumemulaikarirnyadiBKIsejaktahun1986dantelahmendudukijabatandiberbagaiposisiantaralainKepalaCabangBitung(1996-2002),WakilKepalaCabangUtamaBalikpapan(2002-2003),KepalaCabangSingapore(2003-2008),KepalaCabangUtamaBatam(2008-2010).BeliaumeraihgelarSarjanaMesinUniversitasHasanuddin,MakassardangelarSarjanaEkonomidiManado,SulawesiUtara.
56yearsoldservedasPresidentDirectorofPT.BiroKlasifikasiIndonesiaonDecember8,2010.Hebeganhiscareerat PT. Samudera Indonesia Tbk and then as an employee in the Kementerian Perhubungan. His previous positions entailed, among others, in the period 2007 - 2009 as Head of Sub Direktorat Pemanduan dan Penundaan Kapal - DirektoratJenderalPerhubunganLaut,andintheperiod2009-2010servedastheAdministratorofTelukBayurPort-Padang.HeholdsaBachelor'sdegreeintheNauticalMaritimeinLembagaPendidikanTinggiMaritimJa-kartaandManagementMaster'sdegreeinmarketingatInstitutPengembanganKewirausahaanIndonesia(1997).
43yearsoldservedasDirectorofFinanceandPersonnelPT.BiroKlasifikasiIndonesiaonDecember8,2010.HebeganhiscareerasaGeologistinthePT.KaltimPrimaCoal(1994-1995)andlaterasanemployeeintheDirek-toratJenderalBUMNDepartemenKeuangan(2001-2002).Hispreviouspositionsentailed,amongothersasHeadofBusiness Restructuring and Privatization of the Banking and Financial Services (2002 - 2006), Head of Restructur-ingandPrivatizationLogisticsServicesandTourism(2008-2010).HeholdsaBachelorofEngineeringGeologyfromtheUniversitasGajahMada,YogyakartaandMasterofSciencefromtheUniversitasIndonesia.
58yearsoldservedasDirectorofTechnicalandDevelopmentPT.BiroKlasifikasiIndonesiaonDecember8,2010.HebeganhiscareeratBKIsince1980andhasheldpositionsinvariouspositions,includingCirebonBranchHead(1984-1987),HeadofClassificationandCertificationSection,SurveyDivision(1991-1993),HeadofReportingandMonitoringSection,SurveyDivision(1993-1997),HeadofSurveyDivision(1997-2000),HeadofPlanningUnit(2000-2003),HeadofConsultancy&SupervisionUnit(2007-2010).HeholdsaBachelorofShippingEngineeringfrom Institut Teknologi Sepuluh Nopember Surabaya.
57yearsoldservedasDirectorofOperationsandMarketingofPT.BiroKlasifikasiIndonesiaonDecember8,2010.HebeganhiscareeratBKIsince1986andhasheldpositionsinvariouspositionsincludingBitungBranchHead(1996-2002),DeputyHeadoftheBalikpapanMainBranch(2002-2003),HeadofSingaporeBranch(2003-2008),HeadoftheBatamMainBranch(2008-2010).HeholdsaBachelorofEngineeringfromUniversitasHasannuddinandaBachelorofEconomicsinManado,NorthSulawesi.
![Page 24: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/24.jpg)
Annual Report 2011 Laporan Tahunan
24PT Biro Klasifikasi Indonesia (Persero)
Kegiatan Manajerial dan Implementasi GCG
Pelantikan Pejabat
Salah satu hal yang dilakukan oleh Manajemen BKI un-tuk menjamin kinerja manajemen dan organisasi pada tingkat yang baik adalah dengan secara berkala mel-akukan penyegaran organisasi. Berkaitan dengan hal tersebutManajemenBKI dalam tahun 2011melaku-kan dua kali penyegaran organisasi yaitu dalam bulan Januari dan September. Tujuan penyegaran organisasi ini adalah untuk tour of duty dan juga pembinaan pola karier pegawai. Selain itu sekaligus pula untuk menjaga agar Manajemen BKI selalu siap menghadapi peruba-han, tantangan, peluang, dan persaingan usaha yang semakin ketat dan mampu memberikan pelayanan yang lebih baik bagi para pemakai jasa dan pemangku kepentingan.
Managerial Activities and Implementation of GCG
The official inauguration
One of the things that have been done by BKI Man-agement to ensure the performance of management and organization at a good rate is to periodically con-duct refresher organization. In this connection BKI Management in 2011 to double the organization'srefresh in January and September. The purpose ofthis organization is to refresher tour of duty and also coaching career patterns of employees. In addition it is also well to keep the BKI Management always ready to faces the changes, challenges, opportunities, and competition is getting tougher and able to pro-vide better services for users and stakeholders.
Aktifitas ManajemenManagement Activity
![Page 25: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/25.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
25 Annual Report 2011
Rapat Staf
Manajemen BKI secara berkala mengadakan Rapat StafyangdiikutiolehDireksidanparapejabatterkaitPerseroan. Selain sebagai sarana bagi Direksi untukmemberikan pengarahan, dalam Rapat Staf ini juga dilakukan evaluasi dan pembahasan berkaitan dengan pelaksanaan tugas sehari-hari dari masing-masing unit kerja.
Rapat Evaluasi Kinerja
Untuk menjamin agar Perseroan berjalan sesuai ren-cana serta mencapai tujuan dan target yang ditetapkan dalam Rencana Kerja Anggaran dan Pendapatan, pada setiap pertengahan tahun Manajemen BKI menyeleng-garakan Rapat Evaluasi Kinerja Semester I. Dalamacara rapat yang diikuti seluruh pejabat dan kepala unit produksi Perseroan itu dibahas pencapaian target, kendala-kendala yang dihadapi, serta solusi dan kebi-jakan manajemen untuk mengatasi permasalahan yang terjadi dalam praktek di lapangan.
Staff Meeting
BKI Management regularly held staff meetings at-tended by Directors and relevant officials of theCompany. Than as a means for the Board to provide guidance, in a staff meeting was also carried out an evaluation and discussion related to the execution of daily tasks of each work and production unit.
Performance Evaluation Meeting
To ensure that the Company goes according to plan and achieve goals and targets set out in the Work Plan Budget and Revenue, on any mid-year meeting held BKI Management Performance Evaluation ofSemester I. In themeeting that followedbyall offi-cials and heads of production units of the Company's achievement of the targets discussed, obstacles en-countered, and solutions and management policies to address problems that occur in practice in the field.Management Meeting and Technical and Opera-
![Page 26: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/26.jpg)
Annual Report 2011 Laporan Tahunan
26PT Biro Klasifikasi Indonesia (Persero)
Rapat Kerja dan Technical and Operational Meet-ing Surveyor dan Inspector (TOMSI)
Manajemen BKI menetapkan Rencana Kerja Anggaran dan Pendapatan (RKAP) Perusahaan untuk tahun yang akan datang dalam acara Rapat Kerja yang diadakan padapertengahansemesterIItahunberjalan. Dalamacara Rapat Kerja yang diikuti oleh seluruh pejabat struktural Perseoran yang terkait itu juga dibahas re-alisasi target pendapatan dan kinerja korporasi dalam tahun berjalan beserta taksasi pencapaian target yang diproyeksikan dapat diraih. Setelah acara Rapat Kerja kegiatan dilanjutkan dengan Technical and Opera-tional Meeting Surveyor dan Inspector (TOMSI) yang membahas berbagai permasalahan teknis yang terkait dengan pelaksanaan operasional dan pelayanan jasa di bidang klasifikasi dan konsultansi dan supervisi seba-gai bidang usaha utama Perseroan.
Audit Sistem Manajemen Mutu
Untuk menjamin sitem manajemen mutu Perseroan
tional Meeting Surveyor and Inspector (TOMSI)
BKI Management set a Work Plan Budget and Rev-enue (RKAP) of the Company for the coming year in the event of the Management Meeting held in the middle of the second semester of the current year. In theevent attendedbyofficialsassociatedstructuralalso discussed the realization of revenue targets and corporate performance in the current year and a projectedtargetachievement.AftertheManagementMeeting, continued with the Technical and Opera-tional Meeting Surveyor and Inspector (TOMSI) that address various technical issues related to the imple-mentation of operational and service activities in the field of classification and consultancy and supervi-sion as the main business of the Company.
Quality Management System Audit
To ensure the quality of management system stand-
![Page 27: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/27.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
27 Annual Report 2011
sesuai standar ISO9001:2008 secara berkala dilaku-kan audit oleh auditor eksternal dari Global Group Registrar. Audit dilakukan pada unit-unit kerja yang disyaratkan baik di Kantor Pusat maupun Kantor Cabang secara sampling.
Audit Implementasi GCG
Perseroan juga telah menerapkan Prinsip-prinsip Tata Kelola Perusahaan yang Baik atau yang dikenal sebagai Prinsip Good Corporat Covernance (GCG). Terkait dengan hal tersebut Manajemen Perseroan juga telah memenuhi persyaratan tentang perlunya dilakukan au-ditataspelaksanaanPrinsip-prinsipGCGdiBKI.Di-reksiPerseroanbersama-samadenganDewanKomisa-ris dan pihak Auditor bersama-sama membahas hasil temuan audit untuk perbaikan implementasi GCG di Perseroan.
Kerjasama dengan Pihak Terkait
Dengan Badan Pengkajian Penerapan Teknologi (BPPT)
Dalam rangkamendukung pengembangan studi dan
ardsISO9001:2008,Company'speriodicallyauditedby external auditors of the Global Group Registrar. Audit conducted on units of work that required both atHeadOfficeandBranchOfficeinsampling.
GCG Implementing Audit
The Company also implementing the Principles of Good Corporate Governance known as GCG. In re-gard of the GCG, Company’s management has been fullfill the requirements of audit of the implementa-tion of the GCG Principles in BKI. Board of Direc-tors together with the Board of Commissioners and the Auditor together to discuss the audit findings to the improvement in the Company's implementation of GCG.
Cooperation with Related Parties
Cooperation With Badan Pengkajian Penerapan Teknologi (BPPT)
In order to support the development of studies and
![Page 28: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/28.jpg)
Annual Report 2011 Laporan Tahunan
28PT Biro Klasifikasi Indonesia (Persero)
teknologi terkait ketentuan dan proses pembuatan ka-pal fiberglass di Indonesia, Manajemen Perseroan telah menandatangani kerja sama dengan Badan Pengkajian Penerapan Teknologi (BPPT). Melalui kerjasama ini selain menyediakan staf teknik dan peraturan yang terkait, Perseroan juga mendapat manfaat dari hasil studi yang dilakukan yang terkait dengan misi Pers-eroan untuk membantu industri kapal fiberglass dalam meningkatkan kualitas dan memenuhi standar per-syaratan konstruksi yang berlaku.
DenganBadanPemeriksaKeuangan(BPK)
Untuk mengoptimalkan fungsi pengawasan dan pelak-sanaan audit keuangan negara, Badan Pemeriksa Keuangan (BPK) telah menjalin kerjasama dengan Ke-menterian BUMN melalui Nota Kesepahaman tentang penyedian informasi keuangan secara elektronik untuk kepentinganaudit.BerkaitandenganhaltersebutDi-rekturUtamaPerseroanbersamadenganparaDirek-tur Utama BUMN lainnya telah menandatangani Nota Kesepahaman Electrionic Audit (E-Audit) denganBPK.DenganadanyanotakesepahamanininantinyaBPK dapat mengakses data dan informasi keuangan Perseroan secara elektronik sehinga dapat memperce-pat dan mempermudah dalam pengumpulan data dan melakukan review berkaitan dengan audit yang akan dilaksanakan.
provision of related technologies and process of mak-ing fiberglass boats in Indonesia, the Management has entered into cooperation with BPPT. Through this partnership in addition to providing technical staff and associated regulations, the Company also gets a benefit from the results of studies carried out related to the Company's mission to help the fiberglass boat industry to improve quality and meet the construc-tion requirements of the applicable standards.
Cooperation With Badan Pemeriksa Keuangan (BPK)
To optimize the function of supervision and imple-mentation of state financial audit, the State Audit Board (BPK) has formed a partnership with the Ministry of BUMN through a Memorandum of Un-derstanding (MOU) on the provision of financial information electronically for audit purposes. In this regard the Director of the Company together with the Managing Director of another BUMN has signed a Memorandum of Understanding of Electrionic Au-dit(E-Audit)withBPK.WiththisMOU,BPKwillbeable to access data and company financial informa-tion electronically so that it can speed up and simplify the data collection and review relating to the audit to be carried out.
![Page 29: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/29.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
29 Annual Report 2011
Dengan TUV Rheinland
Di tahun 2011 ini Perseroan juga memperluas ker-jasama dengan mitra kerja badan akreditasi dan ser-tifikasi internasional TUV Rheinland yang berpusat di Jerman. Melalui perluasan kerjasama ini kedua pihak sepakat untuk saling memanfaatkan sumber daya mas-ing-masing berkaitan dengan rencana pengembangan kegiatan sertifikasi produk-produk import.
Dengan Korean Ship Safety Technology Authority (KST)
Dalamrangkamengembangkanstuditentangstandardan teknologi keselamatan kapal serta meningkatkan kompetensi dan keahlian sumber daya manusia Pers-eroan di bidang tersebut, Direktur Utama Perseroanjuga telah melakukan penandatanganan Nota Kesepa-haman dengan Korean Ship Safety Technology Author-ity(KST).DenganadanyaNotaKesepahamaniniBKIdan KST sepakat untuk bekerjasama dalam melakukan kajian dan pengembangan standar dan peraturan kes-elamatan untuk kapal-kapal yang berlayar domestik.
Cooperation With TUV Rheinland
In 2011, the Company also expanded cooperationwith partners of international accreditation and cer-tification bodies TUV Rheinland, based in Germany. Through the expansion of this cooperation both par-ties agree to mutually utilize their respective resourc-es associated with the development plan certification activities of imported products.
Cooperation With Korean Ship Safety Technol-ogy Authority (KST)
In order to develop the study of ship safety standards and technologies and increase the competence and expertise of human resources , Director has signed a Memorandum of Understanding with Korean Ship Safety Technology Authority (KST). With this MOU, BKI and KST agreed to cooperate in conducting the study and development of standards and safety regu-lations for the domestic ship.
![Page 30: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/30.jpg)
Annual Report 2011 Laporan Tahunan
30PT Biro Klasifikasi Indonesia (Persero)
Kontribusi Bagi Para Pemangku Kepentingan
Round Table Discussion Badan Litbang Per-hubungan
BKI secara aktif ikut serta dalam berbagai upaya edu-kasi, diskusi, dan seminar untuk meningkatkan pema-haman para pemangku kepentingan berkaitan dengan keselamatan kapal dan perlindungan lingkungan mar-itim. Upaya itu antara lain diwujudkan melalui par-tisipasi Manajemen Perseroan baik sebagai pembicara maupunpembahasdalamforumRoundTableDiscus-sion yang secara berkala diadakan oleh Badan Peneli-tian dan Pengembangan Kementerian Perhubungan.
Kunjungan Peserta Kursus Marine Underwriter
Manajemen Perseroan secara aktif juga melakukan so-sialisasi dan edukasi kepada para peserta kursus ma-rineunderwriter. Diharapkanmelalui sosialisasidanedukasi ini para marine underwriter akan semakin memahami tugas dan peranan badan klasifikasi seba-gai lembaga independen yang melakukan pemeriksaan
Contributions for Stakeholders
Round Table Discussion with Badan Litbang Perhubungan
BKI is actively participating in various educational efforts, discussions, and seminars to improve under-standing of the stakeholders related to the safety of ships and maritime environmental protection. These efforts, among others, realized through the participa-tion of the Company's management as both a speaker and a discussant in a Round Table Discussion fo-rums are regularly held by the Research and Develop-ment Agency –Ministry of Transportation.
Participants of The Marine Underwater Course
Company management also actively disseminate and educate the participant on the Marine Underwriter Course. Hopefully, through socialization and educa-tion, the marine underwriter will understand the du-ties and role as an independent classification body to conduct the examination and assessment of the fea-
![Page 31: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/31.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
31 Annual Report 2011
dan penilaian kelaikan konstruksi lambung dan insta-lasi permesinan suatu kapal dikaitkan dengan kepent-ingan perasuransian.
Indonesian Cabotage Advocation Forum (INCA-FO)
Indonesian Cabotage Advocation Forum (INCAFO)dikenal sebagai forum para praktisi dan pemerhati yang memperjuangkan penerapan azas cabotage secara konsisten dan menyeluruh di Indonesia sesuai amanat Undang-undang Pelayaran nomor 20 Tahun 2008.Forum ini beranggotakanpara tokohduniamaritim,kalangan, akademisi, praktisi, asosiasi terkait dan pen-dukung sektor transportasi laut termasuk BKI. Sebagai komponen bangsa yang terkait langsung dengan sek-tor maritim, BKI secara aktif mendukung langkah dan kegiatan yang digagas oleh Incafo. Direktur UtamaPerseroan secara khusus diudang oleh Incafo untuk bersama-sama menberikan advokasi implementasi azas cabotage ini berkaitan dengan kesiapan BKI se-bagai badan klasifikasi nasional di depan para anggota KomisiVDPRRI.
Acara Talkshow Keselamatan Kapal Penye-berangan
sibility of hull construction and installation of ma-chinery of a vessel associated with insurance interests.
Indonesian Cabotage Advocation Forum (IN-CAFO)
Indonesian Cabotage Advocation Forum (Incafo) known as the forum of practitioners and observers of the fight for the implementation of cabotage princi-ple consistently and thoroughly in Indonesia accord-ing to the mandate of Undang-Undang Pelayaran No 20-2008.Thisforumconsistsofthemaritimeleaders,community groups, academics, practitioners, related associations and supporting marine transportation sector, including BKI. As a component of a nation directly related to the maritime sector, BKI active-ly support the activities initiated by INCAFO. The President Director is specially invited by INCAFO together to gives the implemention advocation of the cabotage principle related to the readiness of BKI as national classification bodies in front of the members of the Komisi V DPR RI.
Talkshow Events of The Safety of Ferry Boats
![Page 32: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/32.jpg)
Annual Report 2011 Laporan Tahunan
32PT Biro Klasifikasi Indonesia (Persero)
Perseroan mendukung upaya yang dilakukan Pemer-intahdalamhal iniDirektorat JenderalPerhubunganLaut dalam melakukan sosialisasi berbagai regulasi dan standar yang terkait dengan kesalamatan pelayaran. Manajemen Perseroan bersama-sama Manajemen PT. ASDPIndonesiaFerry(Persero)mendampingiDirjenPerhubungan Laut sebagai nara sumber dalam acara talkshow di TV yang mengangkat tema aspek kes-elamatan kapal penyeberangan.
Seminar Tenik BKI – KR
Perseroan bekerjasama dengan mitra badan klasifikasi anggota International Association of Classification So-ciety (IACS), Korean Register of Shipping (KR) menye-lenggarakan seminar teknik bersama yang ditujukan bagi para pemangku kepentingan. Dalam seminaritu disampaikan berbagai perkembangan standar dan teknologi terkait bidang keselamatan kapal serta hasil penelitian KR yang relevan.
Seminar Teknik Bersama BKI – KR – IPERINDO
The Company supports the efforts of the Government, cq. Directorate General of Sea Transportation in in-formation dissemination regulations and standards related to safety of sea transportation. Management jointly Management of PT. ASDP Indonesia Ferry(Persero) assist the Director General of Sea Transpor-tation as a resource in talk show on TV of the theme the safety aspects of the ferryboat.
Technical Seminar BKI – KR
Company in collaboration with partner agencies clas-sifications member of the IACS, Korean Register of Shipping (KR) held a joint technical seminar is in-tended for all stakeholders. The seminar was deliv-ered some variety of standards and technology devel-opments related to the ship safety and KR relevant research results.
Joint Technical Seminar BKI - KR – IPERINDO
![Page 33: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/33.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
33 Annual Report 2011
Dalam rangka upaya mengembangkan rencana ker-jasama pembangunan kapal, Perseroan bersama Ika-tan Perusahaan Industri Kapal dan Sarana Lepas Pan-tai(IPERINDO)danclasspartnerKoreanRegisterofShipping (KR) mengadakan seminar teknik bersama. DalamseminarinipihakKRmembagipengalamannyaberkaitan dengan indstri galangan kapal dan hal-hal yang dapat dikerjasamakan di antara para pihak.
Pengembangan Usaha
Penjajagan Kerjasama dengan Mitra Usaha di Re-publik Rakyat China
Salah satu negara yang memiliki industri maritim dan galangan kapal yang maju adalah RRC dan banyak pengusaha pelayaran Indonesia yang membangun atau membeli kapal dari RRC. Sejalan dengan hal tersebut Manajemen Perseroan melakukan kunjungan ke RRC untuk menjajagi kemungkinan kerjasama dengan mi-tra setempat untuk pembukaan kantor perwakilan BKIdiShanghai. Diharapkandenganadanyakantorperwakilan BKI di RRC ini nantinya pelayanan BKI kepada para pengusaha nasional akan lebih cepat dan dapat pula memberikan jasa sertifikasi material dan komponen yang diimport dari RRC yang akan diguna-kan oleh galangan kapal dalam negeri.
Inanefforttodevelopajointplanofshipbuilding,the Company together with the Ikatan Perusahaan Industri Kapal dan Sarana Lepas Pantai (IPERIN-DO) and class partner Korean Register of Shipping (KR)heldajointtechnicalseminar.Inthisseminarthe KR share their experiences related to shipbuilding and the things can be cooperating between the par-ties.
Business Development
Possibility of the cooperation with business part-ners in the People's Republic of China
A country that has leading maritime industry and advanced shipbuilding is the PRC , which many Ido-nesian shipping businessesman build or buy ships. In line with this, the Management Company made a visit to the PRC to explore possible cooperation with localpartnerstoopenaBKIrepresentativeofficeinShanghai.Itisexpectedthatarepresentativeofficeinthe PRC can provide faster services to the nationwide bussinessman and also provide certification services of materials and components imported from the PRC to be used by domestic shipyards.
![Page 34: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/34.jpg)
Annual Report 2011 Laporan Tahunan
34PT Biro Klasifikasi Indonesia (Persero)
Temu Pelanggan
Manajemen Perseroan secara berkala menjalin ko-munikasi langsung dengan para pemakai jasa melalui acara temupelanggan. Dalamacara temupelangganini Manajemen Perseroan selain berdialog dan me-nampung keluhan berkaitan dengan pelayanan jasa BKI juga menyampaikan berbagai informasi terkini berkaitan dengan regulasi dan aspek teknik terkini yang terkait dengan keselamatan kapal.
Prensentasi Bidang Klasifikasi di Staf Komando Lo-gistik TNI AL
Perhatian kepada BKI datang bukan hanya dari kalangan pengusaha pelayaran yang memiliki dan mengoperasikan kapal-kapal niaga tetapi juga dari TNI AL. Staf Komando Logistik Angkatan Laut (SKOGAL) mengundangdalam tahun2011mengunganManaje-men BKI untuk melakukan presentasi berkaitan den-gan notasi klasifikasi kapal. Dalam kesempatan ituManajemen BKI memaparkan berbagai aspek yang perlu diperhatikan menyangkut titik-titik lemah kon-
Customer Gathering
Company's management periodically to establish di-rect communication with customer through customer gathering. In the gathering,the Company’s Manage-ment hold a dialogue with service-related complaints and also deliver a range of current information re-lated to the regulatory and technical aspects related to the safety of the ship.
Classification Presentation in the Navy Logistics Command Staff
Attention to the BKI came not only from the business that owns and operates cruise ships but also from the navy.The Navy Logistics Command Staff (SKOGAL) in2011inviteBKIManagementtomakeapresenta-tion relating to the ship classification notations. On that occasion BKI Management describes the various aspects that need to be considered weak spots con-cerning ship construction. For the future the Navy will prepare a plan for BKI to inspect and supervise
![Page 35: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/35.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
35 Annual Report 2011
struksi kapal. Untuk ke depannya TNI AL akan me-nyiapkan rencana menggandeng BKI untuk melaku-kan pengawasan armada kapalnya yang dibangun di galangan nasional.
Menerima Kunjungan Pejabat INPEX Masela Ltd. Jakarta
Kepercayaan terhadap Perseroan terus tumbuh seja-lan dengan reputasi baik dan kiprahnya dalam bidang keselamatan kapal dan industri maritim yang berhasil dibukukan. Manajemen INPEXMasela Ltd. JakartaselakupemilikdanoperatorkapalFLNGMaselayangakan dioperasikan di Blok Masela melakukan kunjun-gan ke Kantor Pusat BKI untuk mengetahui kesiapan Perseroan dalam melakukan pemeriksaan dan peng-klasan kapal tersebut bersama class partner American Bureau of Shipping (ABS).
Menerima Kunjungan Pejabat BP Migas
their fleet was built in national shipyards.
Receive an Official Visit from INPEX Masela Ltd. Jakarta
Confidence to the Company growing continuesly in line with a good reputation on ship safety and marine industrieswhich successfullyposted. INPEXMaselaManagementLtd.Jakartaastheownerandoperatorof Masela FLNG will be operated in Masela Block, visited BKI Headquarters to find out the readiness of the Company in conducting examinations and classed the ship in class - partner with the American Bureau of Shipping (ABS).
Receive an official visit from BP Migas
KepalaDivisiPenunjangOperasiBPMigasmelakukankunjungan ke BKI untuk mengetahui kesiapan dan ke-mampuan Perseroan dalam menangani proyek-proyek
Head of BP Migas Operations Support Division made a visit to BKI to find out the readiness and capability inhandlingprojectofoilandgasprojects.BPMigas
![Page 36: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/36.jpg)
Annual Report 2011 Laporan Tahunan
36PT Biro Klasifikasi Indonesia (Persero)
Migas. BP Migas dalam berbagai kesempatan selalu berupaya mempromosikan dan mendukung keterli-batan industri dalam negeri dalam kegiatan eksplorasi danoperasionalbidangMigas.DalamkesempatanituManajemen Perseroan mempresentasikan hal-hal yang terkait dengan pengalaman dan kesiapan BKI dalam menangani pekerjaan di sektor Migas baik untuk klasi-fikasi maupun konsultansi dan supervisi.
Menerima Kunjungan Delegasi Industrial and Trade Chamber Turki
on various occasions are always working to promote and support the involvement of the domestic industry in exploration and oil and gas field . On that occa-sion the Company's management presented matters related to the experience and readiness of BKI in han-dlingbothjobsatOilandGassectorforclassificationas well as consultation and supervision.
Receive Delegation Visits Industrial and Trade Chamber Turkey
Dalamkesempatanmengikuti kunjungankenegaraanpresiden Turki, Kamar Dagang dan Industri TurkiKompartemen Maritim melakukan kunjungan ke BKI sebagai institusi yang dinilai banyak mengetahui dan memahami industri perkapalan di Indonesia. Mana-jemen BKI memberikan penjelasan mengenai ruang lingkup tugas, kompetensi, dan pengalaman BKI serta perkembangan industri galanan kapal di Indoesia dan pihak Turki pun menawarkan kemungkinan-kemung-kinan kerjasama yang dapat dikembangkan di antara kedua negara.
Kontrak Proyek Dengan CNOOC SES Ltd.
On the opportunity to follow the state visit of Presi-dent of Turkey,The Marine Compartment as part of Turkish Chamber of Commerce and Industry visited BKI as an institution that valued a lot to know and understand the shipping industry in Indonesia. BKI management gives an explanation of the scope of du-ties, competence, and experience as well as develop-ment of Shipbuilding Industry in Indonesia and the Turkey side offers the possibilities of developed in co-operation between the two countries.
Project Contract With CNOOC SES Ltd.
![Page 37: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/37.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
37 Annual Report 2011
Salah satu pengakuan penting industri Migas kepada Perseroan adalah kepercayaan China National Off-shoreOilCompanySouthEastSumatra(CNOOCSES)Ltd untuk menyerahkan assessment dan sertifikasi klas untuk single point mooring system yang digunakannya kepada BKI. Penandatanganan kontrak proyek terse-butdilakukanolehDirekturUtamaPerseroandanDi-rekturUtamaCNOOCSESLtddiJakarta.
Sinergi Dengan PT. PANN (Persero)
Perseroan senantiasa mendukung upaya-upaya mewu-judkan sinergi antar BUMN. Menjelang akhir tahun 2011 Manajemen menandatangani Nota Kesepaha-man pengembangan Sinergi Antar BUMN dengan PT. PANN (Persero) dengan disaksikan oleh Deputi Bi-dang Usaha Jasa Kementerian Negera BUMN. Mela-lui Nota Kesepahamanan kedua pihak sepakat untuk mengembangkan kerjasama konsultasi dan supervisi pemeliharaan kapal-kapal milik PT. PANN (Persero).
One of the important recognition of the oil and gas industry to BKI is the trust of China National Off-shore Oil Company South East Sumatra (CNOOCSES) Ltd to deliver their assessment and class cer-tification for single point mooring system to BKI. ThesigningofthecontractprojectundertakenbythePresident Director of BKI and the President Director ofCNOOCSESLtdinJakarta.
Synergy with PT. Pann (Limited)
The Company continually support efforts to achieve synergies among BUMN. Towards the end of 2011Management signed a MOU for the development of Synergies Between BUMN with the state-owned PT. PANN (Persero), witnessed by the Deputi Bidang UsahaJasa–KementerianBUMN.ThroughaMOUboth parties agree to develop cooperation in con-sultation and supervised the maintenance of ships owned by PT. PANN (Persero).
![Page 38: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/38.jpg)
Annual Report 2011 Laporan Tahunan
38PT Biro Klasifikasi Indonesia (Persero)
ActivitiesActivities
![Page 39: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/39.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
39 Annual Report 2011
Klasifikasi Kapal
Persetujuan Gambar
Aktifitas Survey Klasifikasi
Aktivitas Jasa Industri
Survey Statutoria
Otorisasi Statutoria
Konsultasi & Supervisi
Pengujian & Laboratorium
Rekayasa Teknik
Inspeksi & Supervisi Maritim
Pelatihan publik
Ship Classificaton
Drawing Approval
Classification Survey Activities
Industrial Services Activities
Statutory Survey
Statutory Authorization
Consultancy & Supervision
Testing & Laboratory
EngineeringDesign
Marine Inspection & Supervision
Public Training
![Page 40: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/40.jpg)
Annual Report 2011 Laporan Tahunan
40PT Biro Klasifikasi Indonesia (Persero)
DampakditerbitkannyaInstruksiPresidenRepublikIn-donesiaNo5tahun2005tentangpemberdayaanindustripelayaran nasional dan Permenhub KM. 20 tahun 2006 tentang kewajiban kapal bendera Indonesia memiliki klasifikasi dari BKI menyebabkan terjadinya peningkatan penerimaan register kapal kelas BKI, meskipun masih di-dominasi penerimaan kelas bangunan sudah jadi diband-ingkan dengan penerimaan kelas bangunan baru.
JumlahkapalyangdiregisterpadaakhirDesember2011berjumlah14.754unitatau111,29%lebihbesardiband-ingkantahun2010dengantotalGrossTonnagemencapai18.775.872GT.Jumlahpenambahankapalyangdiregis-terpadatahun2011adalah1.497unitatau3.188.086GT.
Impactof theINPRESNo.5-2005ontheempower-ment of the national shipping industry and Permen-hub KM. 20- 2006 on the obligations of the Indone-sia flag ship classed to BKI has resulted in increasing acceptance of BKI registered class ships, though still dominatedbyExistingShipsAdmissionClass(PKBL)compared to the New Building Admission Class.
The number of vessels registered at the end of Decem-ber2011amountedto14754unitsor111.29%high-erthanin2010withatotalGrossTonnagereached18,775,872GT.Thenumberofadditionalvesselsreg-isteredin2011was1497unitsor3,188,086GT.
Klasifikasi KapalShip Classification
Year Unit GT
20112010200920082007
14.75413.25712.43611.28110.601
18.775.87215.587.78613.652.22311.561.46110.524.808
Ship Age Unit GT
0-56-1011-1516-2021-25>25
2.6611.246815868618
1.355
3.987.4341.341.1551.040.3041.453.5951.290.5782.939.934
Kapal Register tahun 2007-2011ShipsRegisteredfrom2007to2011
Kapal Kelas Valid sesuai umur Valid Class Ships by ship age
![Page 41: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/41.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
41 Annual Report 2011
Kapalyangdicabutkelasnyasampaidengantahun2011adalah 7.226 unit atau 6.827.718 GT. Pencabutan kelasini dengan alasan tidak memenuhi persyaratan Rules & Regulation dengan mulai diterapkannya Automatic Class Suspension, pindah ke badan klasifikasi lain, tenggelam, discrapp atau permintaan dari pemilik kapal. Sehingga kapal kelas BKI dengan status klas berlaku (valid class), meningkatdaritahun2010yangsebesar6.400unitden-gantonasetotal9.594.091GTmenjadi7.528unitdengantonasetotal11.948.154GT.
Class withdrawn ship in 2011 was 7226 units or6,827,718 GT. The reason of this class withdrawnwere failure to fulfill Rules & Regulations as starting the implementation of Automatic Class Suspension, change of classification bodies, sinking, scrapping or request from the ship’s owner. So that, the BKI class ships with valid class status increase from amounted of6400unitswithtotaltonnageof9,594,091in2010into7528unitswithtotaltonnageof11,948,154GTin2011.
Kapal Register 2007 – 2011
Unit Gross Tonage
Unit GT
16,000
14,000
12,000
10,000
8,000
6,000
4,000
2,000
0
2007 2008 2009
10,601 11,28112,436
13,25714,754
2010 2011
0 - 52,66135%
> 251,35518%
21 - 2 56288%
16 - 2 086812%
11 - 1 581511%
6 - 101,24616%
>252,939,934
24%
21 - 2 51,290,578
11%16 - 2 0
1,453,59512%
11 - 1 51,040,304
9%
6 - 101,341,155
11%
0 - 53,987,434
33%
Kapal Kelas Valid sesuai umur (unit)
Unit Gross Tonage
![Page 42: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/42.jpg)
Annual Report 2011 Laporan Tahunan
42PT Biro Klasifikasi Indonesia (Persero)
Rincian Tipe Kapal yang diregister Breakdown of type of ships
Rincian Tipe Kapal yang diregister (Unit) Breakdown of type of ships
Rincian Tipe Kapal yang diregister (GT) Breakdown of type of ships
Ship Type Unit total GRT Total
Passenger & FerryGeneral CargoBulk CarrierContainer ShipTankerOthers
30482232
154369
5902
374.0281.370.249
660.267887.255
21.92.1846.603.853
![Page 43: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/43.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
43 Annual Report 2011
Annual Report 2011 Laporan Tahunan
![Page 44: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/44.jpg)
Annual Report 2011 Laporan Tahunan
44PT Biro Klasifikasi Indonesia (Persero)
Daftar Penerimaan Kelas Bangunan Baru Tahun 2011 ListofAdmissionofNewBuilding2011
Nama Kapal Jenis Kapal GT (Ton)
Dimension (m)
Pemilik Galangan
TanjungBuyut2-212
Daya12Kalindo Permai 3SatriaLaksana248Bahar1291LintasXXIKwan1MarcoDabo103
Dabo20
L.L.BSukses8OasisIX
Del01Marina 2433Adhi1Buana Power VI
KaryaPacific11Sanle21Dabo605
Eti103
SinarSejahtera128
OniXIIPerkasa 3Kyk01Eti304
Kapal Tunda
Kapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal Tunda
Kapal Tunda
Kapal TundaKapal Tunda
Kapal TundaKapal TundaKapal TundaKapal Tunda
Kapal TundaKapal TundaKapal Tunda
Kapal Tunda
Kapal Tunda
Kapal TundaKapal TundaKapal TundaKapal Tunda
291
153148148167207148163116
153
146163
25122214665
2078066
207
137
112207207207
26.88x9.4x4.5
21.98x7.3x3.221.65x7.32x3.221.79x7.32x3.222.32x7.6x2.824.85x8.2x421.65x7.32x3.223.37x8x3.319.25x6.6x3.1
21.98x7.3x3.2
22.17x7.32x3.122.32x7.6mx2.8
25.82x8.6x4.327.36x8x3.722.17x7.32x3.115.55x6.1x2.44
24.26x8.2x417.28x5.8x2.716.2x5.5x2.85
24.85x8.2x4
21.69x7.32x3.2
19.53x6.5x2.7524.85x8.2x424.85x8.2x424.67x8.2x4
PT. Pelindo II (Persero) Cabang PalembangPT.DayaBahteraSumateraPT. Pelayaran Nautica PacificPT. Artha Gunung MasPT. Habco PrimatamaPT. Lintas Samudra Borneo LinePT. Kwan Samudera MandiriPT.EkawiraSwadayaAbadiPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Pelayaran Laju Lintas BahariPT. Pelayaran Nasional Armada Sumber RezekiPT.DelNavigiaPT. Bahtera Bestari ShippingPT.AdhimixPelayaranInternusaPT. Buana Transperindo Wahana InternasionalPT. Karya Pacific ShippingPT. Whs Global MandiriPT. Pelayaran Nasional Bahtera Bestari ShippingPT.EnergyTransporterIndonesia
PT. Sinar Tanjung
PT. OniPT. Sanditia Perkasa MaritimPT. Kyk LinesPT.EnergyTransporterIndonesia
PT.DayaRadarUtama
PT. Bahtera Bahari ShipyardPT. Karya Teknik UtamaPT. Bahtera Bahari ShipyardPT. Cahaya Samudera ShipyardPT. Karya Teknik UtamaPT. Karya Teknik UtamaPT. Alima Usaha SamuderaPT. Bahtera Bahari Shipyard
PT. Bahtera Bahari Shipyard
PT. Nongsa Jaya BuanaPT. Cahaya Samudera Shipyard
PT. Karya Teknik UtamaPT. Bahtera Bahari ShipyardPT. Nongsa Jaya Buana Nil
PT. Karya Teknik UtamaPT. Alima Usaha SamuderaPT. Bahtera Bahari Shipyard
PT. Karya Teknik Utama
PT. Karyasindo Samudra Biru ShipyardPT. Sumber Samudra MakmurPT. Karya Teknik UtamaPT. Karya Teknik UtamaPT. Karya Teknik Utama
![Page 45: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/45.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
45 Annual Report 2011
Nama Kapal Jenis Kapal GT (Ton)
Dimension (m)
Pemilik Galangan
KKS1281Kalindo Permai 2L.L.B Sukses 6SPGM1288
TirtayasaIV216Oni VMts IIILotus 22-07
Bahar 79TanjungBuyut3-212
Eti306Dabo601
Aditya01Dabo607
Buana Power II
Bintan Karisma III
MajuDaya35Dabo806
Buana Power III
Buana Power IV
Buana Power V
BSPXPerkasa1MitraKencanaXIMarina 29
Trans Pacific 203Miduk OceanTitan 03TirtayasaIII-216SeiDeliCakra1
Maiden Island
Dabo802
Bintan Karisma IIBaruna1BSI IIIDabo805
Kapal TundaKapal TundaKapal TundaKapal Tunda
Kapal TundaKapal TundaKapal TundaKapal Tunda
Kapal TundaKapal Tunda
Kapal TundaKapal Tunda
Kapal TundaKapal Tunda
Kapal Tunda
Kapal Tunda
Kapal TundaKapal Tunda
Kapal Tunda
Kapal Tunda
Kapal Tunda
Kapal TundaKapal TundaKapal TundaKapal Tunda
Kapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal Tunda
Kapal Tunda
Kapal Tunda
Kapal TundaKapal TundaKapal TundaKapal Tunda
186148146137
296102148245
99291
20766
22280
65
88
185116
65
65
65
138207138222
21120725529634795
188
116
88207185116
23.94x8x3.6521.65x7.32x3.222.17x7.32x3.121.69x7.32x3.2
27.93x9.5x3.819.48x6.5x2.7521.32x7.31x3.227.98x9x3.8
17.42x5.8x2.9626.88x9.4x4.5
24.85x8.2x416.2x5.5x2.85
27.36x8x3.716.2x5.5x2.85
15.55x6.1x2.44
19.39x6.1x2.75
24.28x8x3.6520.21x6.6x3.1
15.55x6.1x2.44
15.55x6.1x2.44
15.55x6.1x2.44
21.16x7.32x3.224.85x8.2x421.88x7.32x3.227.36x8x3.8
26.88x8x3.724.85x8.2x426.25x8.6x4.327.93x9.5x3.830.24x9.8x4.617.42x5.8x2.96
24.35x8x3.65
20.21x6.6x3.1
19.39x6.1x2.7524.85x8.2x424.3x8x3.6520.21x6.6x3.1
Wiwik MasluhaPT. Nautica PacificPT. Pelayaran Laju Lintas BahariPT. Megah Mandiri Sukses Sejati
PT. Pelindo II (Persero)PT. OniPT. Mitra Tujuh SamudraPT. Pelayaran Syukur Citra Prima
PT. Habco PrimatamaPT. Pelindo II (Persero) Cabang PalembangPT.EnergyTransporterIndonesiaPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Pasifik Bintan Indo ShippingPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Buana Transperindo Wahana InternasionalPT. Pelayaran Nasional Bintan Karisma LinePT. Pelayaran Asia Mega LinesPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Buana Transperindo Wahana InternasionalPT. Buana Transperindo Wahana InternasionalPT. Buana Transperindo Wahana InternasionalPT. Budi Samudra PerkasaPT. Sanditia Perkasa MaritimPT. Sumber Surya Kencana InhuPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Trans Pacific JayaPT. Mitsi Citra MandiriPT. Nusantara Terminal TerpaduPT. Pelindo II (Persero)PT. Pelindo I (Persero)PT.PelayaranNasionalFajarMarindo RayaPT. Pelayaran Multi Jaya Sam-uderaPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Technics Offshore JayaPT. Baruna Power LinePT. Berjaya Samudera IndonesiaPT. Pelayaran Nasional Bahtera Bestari Shipping
NilPT. Karya Teknik UtamaPT. Nongsa Jaya BuanaPT. Karyasindo Samudra Biru ShipyardPT.DayaRadarUtamaPT. Sumber Samudra MakmurPT. Bandar Victory ShipyardPT. Mangkupalas Mitra MakmurPT.BatamExpresindoShipyardPT.DayaRadarUtama
PT. Karya Teknik UtamaPT. Bahtera Bahari Shipyard
PT. Bahtera Bahari ShipyardNil
PT. Nongsa Jaya Buana
PT. Nongsa Jaya Buana
PT. Bandar Abadi ShipyardPT. Bahtera Bahari Shipyard
PT. Nongsa Jaya Buana
PT. Nongsa Jaya Buana
PT. Nongsa Jaya Buana
PT. Sumber Samudra MakmurPT. Karya Teknik UtamaPT. Sumber Samudra MakmurPT. Bahtera Bahari Shipyard
PT. Galangan MercusuarPT. Karya Teknik UtamaPT. Bandar Abadi ShipyardPT.DayaRadarUtamaPT.Dok&PerkapalanSurabayaPT.BatamExpresindoShipyard
PT. Waruna Nusa Sentana
PT. Bahtera Bahari Shipyard
PT. Nongsa Jaya BuanaPT. Karya Teknik UtamaPT. Bandar Abadi ShipyardPT. Bahtera Bahari Shipyard
![Page 46: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/46.jpg)
Annual Report 2011 Laporan Tahunan
46PT Biro Klasifikasi Indonesia (Persero)
Nama Kapal Jenis Kapal GT (Ton)
Dimension (m)
Pemilik Galangan
Buana Power III
Buana Power IV
Buana Power V
BSPXPerkasa1MitraKencanaXIMarina 29
Trans Pacific 203Miduk OceanTitan 03TirtayasaIII-216SeiDeliCakra1
Maiden Island
Dabo802
Bintan Karisma IIBaruna1BSI IIIDabo805
TirtayasaII-212Berkat Mandiri IIOcean Venture IIIOcean Venture IIBataviaII216Dabo803
BSI IBintan Karisma ITirtayasaI-212Bangun1Dabo801
Eti102Prima Power 02CavaloMarinho01Rayyan Salumbung 2200-1Putra Rupat III
KalindoPermai1Eti101TanairXI
Kapal Tunda
Kapal Tunda
Kapal Tunda
Kapal TundaKapal TundaKapal TundaKapal Tunda
Kapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal Tunda
Kapal Tunda
Kapal Tunda
Kapal TundaKapal TundaKapal TundaKapal Tunda
Kapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal Tunda
Kapal TundaKapal TundaKapal TundaKapal TundaKapal Tunda
Kapal TundaKapal TundaKapal TundaKapal Tunda
Kapal Tunda
Kapal TundaKapal TundaKapal Tunda
65
65
65
138207138222
21120725529634795
188
116
88207185116
2691508888
269116
18588
269207116
211211185220
226
207211189
15.55x6.1x2.44
15.55x6.1x2.44
15.55x6.1x2.44
21.16x7.32x3.224.85x8.2x421.88x7.32x3.227.36x8x3.8
26.88x8x3.724.85x8.2x426.25x8.6x4.327.93x9.5x3.830.24x9.8x4.617.42x5.8x2.96
24.35x8x3.65
20.21x6.6x3.1
19.39x6.1x2.7524.85x8.2x424.3x8x3.6520.21x6.6x3.1
27.93x9.5x3.821.99x7.32x3.219.39x6.1x2.7519.39x6.1x2.7528.42x9.5x3.820.21x6.6x3.1
24.3x8x3.6519.39x6.1x2.7527.93x9.5x3.824.85x8.2x420.21x6.6x3.1
26.88x8x3.727.12x8x3.724.12x8x3.6524.85x8.2x4
26.78x9x4.16
24.85x8.2x427.12x8x3.723.52x7.32x3.2
PT. Buana Transperindo Wahana InternasionalPT. Buana Transperindo Wahana InternasionalPT. Buana Transperindo Wahana InternasionalPT. Budi Samudra PerkasaPT. Sanditia Perkasa MaritimPT. Sumber Surya Kencana InhuPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Trans Pacific JayaPT. Mitsi Citra MandiriPT. Nusantara Terminal TerpaduPT. Pelindo II (Persero)PT. Pelindo I (Persero)PT.PelayaranNasionalFajarMarindo RayaPT. Pelayaran Multi Jaya Sam-uderaPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Technics Offshore JayaPT. Baruna Power LinePT. Berjaya Samudera IndonesiaPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Pelindo II (Persero)PT. Mandiri LinePT. Ocean VenturePT. Ocean VenturePT. Pelindo II (Persero)PT. Pelayaran Nasional Bahtera Bestari ShippingPT. Berjaya Samudera IndonesiaPT. Technics Offshore JayaPT. Pelindo II (Persero)PT. Renjani Maritim TransportasiPT. Pelayaran Nasional Bahtera Bestari ShippingPT.EnergyTransporterIndonesiaPT. Lintas Prima PerkasaPT. Segara Transindo MandiriPT. Barru Bahari Lines
PT. Pelayaran Lestari Papua BahariPT. Kalindo UtamaPT.EnergyTransporterIndonesiaPT. Pelayaran Tanair Pratama Nusantara
PT. Nongsa Jaya Buana
PT. Nongsa Jaya Buana
PT. Nongsa Jaya Buana
PT. Sumber Samudra MakmurPT. Karya Teknik UtamaPT. Sumber Samudra MakmurPT. Bahtera Bahari Shipyard
PT. Galangan MercusuarPT. Karya Teknik UtamaPT. Bandar Abadi ShipyardPT.DayaRadarUtamaPT.Dok&PerkapalanSurabayaPT.BatamExpresindoShipyard
PT. Waruna Nusa Sentana
PT. Bahtera Bahari Shipyard
PT. Nongsa Jaya BuanaPT. Karya Teknik UtamaPT. Bandar Abadi ShipyardPT. Bahtera Bahari Shipyard
PT.DayaRadarUtamaPT. Alima Usaha SamuderaPT. Nongsa Jaya BuanaPT. Nongsa Jaya BuanaPT.DayaRadarUtamaPT. Bahtera Bahari Shipyard
PT. Bandar Abadi ShipyardPT. Nongsa Jaya BuanaPT.DayaRadarUtamaPT. Karya Teknik UtamaPT. Bahtera Bahari Shipyard
PT. Galangan MercusuarPT. Galangan MercusuarPT. Bandar Abadi ShipyardPT. Karya Teknik Utama
PT. Citra Shipyard
PT. Karya Teknik UtamaPT. Galangan MercusuarPT. Galangan Mercusuar
![Page 47: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/47.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
47 Annual Report 2011
Nama Kapal Jenis Kapal GT (Ton)
Dimension (m)
Pemilik Galangan
Putra Rupat V
Titan05Prima10BataviaI-216
Eti301Pasifik188Ghitha 02Nusa1Putra Rupat VI
TerusDaya33Ghitha01Masada 09Daya11Muarajati01Sumber JasaPerkasa 2Dabo603Dabo606Farel01
MitraKencanaXIIEti303SamudraBintan89
Farel02Marina 30
Marina31
Eti302Eti305Dabo602
Dabo101
PrimaPower05Arya ChandraBada Leon
MarselaSiginjai
MuyuManta
Arar
KalibodriTanjung Madlahar
Kapal Tunda
Kapal TundaKapal TundaKapal Tunda
Kapal TundaKapal TundaKapal TundaKapal TundaKapal Tunda
Kapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal TundaKapal Tunda
Kapal TundaKapal TundaKapal Tunda
Kapal TundaKapal Tunda
Kapal Tunda
Kapal TundaKapal TundaKapal Tunda
Kapal Tunda
Kapal TundaKapal Tunda
Kapal Penyeberangan
Kapal PenyeberanganKapal Penyeberangan
Kapal PenyeberanganKapal Penyeberangan
Kapal Penyeberangan
Kapal PenyeberanganKapal Penyeberangan
226
254207269
207108207214226
259209207148129
79207
6680
220
188220105
220222
222
207207
66
116
211207616
616616
370627
617
1823500
26.78x9x4.16
26.2x8.6x4.324.85x8.2x427.93x9.5x3.8
24.85x8.2x419.53x6.5x2.7524.85x8.2x424.85x8.2x426.78x9x4.16
26.2x8.6x4.324.85x8.2x424.85x8.2x421.79x7.32x3.222.08x7.1x3.117.28x5.8x2.724.85x8.2x416.2x5.5x2.8516.2x5.5x2.8524.85x8.2x4
23.23x8x3.6524.85x8.2x419.58x8.6x4.3
24.85x8.2x427.36x8x3.8
27.36x8x3.7
24.19x8.2x424.85x8.2x416.2x5.5x2.85
20.21x6.6x3.1
26.88x8x3.724.67x8.2x440.6x12x3.2
40.6x12x3.240.6x12x3.2
35.04x10.5x2.840.6x12x3.2
40.6x12x3.2
61.8x14x4.135.04x10.5x2.8
PT. Pelayaran Lestari Papua BahariPT. Nusantara Terminal TerpaduPT. Maritim Prima MandiriPT. Pelindo II (Persero) Cabang Tanjung PriokPT.EnergyTransporterIndonesiaPT. Pasifik Bintan Indo ShippingPT. Global Samudra NusantaraPT. Cakrawala Nusa BahariPT. Pelayaran Lestari Papua BahariPT. Pelayaran Asia Lestari LinesPT. Global Samudra NusantaraPT. Masada Jaya LinesPT.DayaBahteraSumateraPT. Pelindo II Cabang CirebonPT.SumberDayaCiPTaAlamPT. Sanditia Perkasa MaritimPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Batulicin Nusantara MaritimPT. Sumber Surya Kencana InhuPT.EnergyTransporterIndonesiaSu Meng LiangPT. Batulicin Nusantara MaritimPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Pelayaran Nasional Bahtera Bestari ShippingPT.EnergyTransporterIndonesiaPT.EnergyTransporterIndonesiaPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Pelayaran Nasional Bahtera Bestari ShippingPT. Lintas Prima PerkasaPT.DutaBahariMenaraLineDitjenPerhubunganDarat
DitjenPerhubunganDaratDitjenPerhubunganDarat
DitjenPerhubunganDaratDishubKaltim
DitjenPerhubunganDarat
DitjenPerhubunganDaratDitjenPerhubunganDarat,DirektoratLLASDP
PT. Citra Shipyard
PT. Bandar Abadi ShipyardPT. Karya Teknik UtamaPT.DayaRadarUtama
PT. Karya Teknik UtamaPT. Alima Usaha SamuderaPT. Karya Teknik UtamaPT. Karya Teknik UtamaPT. Citra Shipyard
PT. Bandar Abadi ShipyardPT. Karya Teknik UtamaPT. Karya Teknik UtamaPT. Bahtera Bahari ShipyardPT. Sanur Marindo ShipyardPT. Alima Usaha SamuderaPT. Karya Teknik UtamaPT. Bahtera Bahari ShipyardPT. Bahtera Bahari ShipyardPT. Karya Teknik Utama
PT. Sumber Samudra MakmurPT. Karya Teknik UtamaPT.Alima Usaha Samudera
PT. Karya Teknik UtamaPT. Bahtera Bahari Shipyard
PT. Bahtera Bahari Shipyard
PT. Karya Teknik UtamaPT. Karya Teknik UtamaPT. Bahtera Bahari Shipyard
PT. Bahtera Bahari Shipyard
PT. Galangan MercusuarPT. Karya Teknik UtamaPT.DumasTanjungPerakShipyardNilPT.DumasTanjungPerakShipyardPT. Industri Kapal IndonesiaPT.Dok&PerkapalanKodjaBahariPT. Adiluhung Sarana Segara IndonesiaPT. Noahtu ShipyardPT.DayaRadarUtama
![Page 48: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/48.jpg)
Annual Report 2011 Laporan Tahunan
48PT Biro Klasifikasi Indonesia (Persero)
Nama Kapal Jenis Kapal GT (Ton)
Dimension (m)
Pemilik Galangan
Cantika Anugerah
Napan Wainami
Tanjung Api
Lome
GilicatEnterprisePegasusTunasTerafulk1Ina SelaKPC Selat Kijang 02MPW AC 02KPCSelatKijang01KPCSelatDurianKPC Sei Nunang 02KPCSeiNunang01MPAC01
MPA C 02MPAC001Kapuas265
CitraMandiri2015
Hafar NeptuneNaga BiruTirtaSamudraXXIII
GrahaDuaDua
TirtaSamudraXXV
TirtaSamudraXXI
TirtaSamudraXXII
Seroja I
Clement II
BSPXI
BSPIX
Kapal Penye-berangan
Kapal Penye-berangan
Kapal Penye-berangan
Kapal Penye-berangan
Crew BoatCrew BoatCrew BoatCrew Boat
Kapal PanduKapal PanduKapal PanduKapal PanduKapal PanduKapal PanduKapal PanduKapal PanduKapal Pandu
Tongkang Minyak
Tongkang Air
Tongkang KerjaTongkang KerjaTongkang Min-yak Berpeng-gerak Sendiri
Tongkang Min-yak Berpeng-gerak Sendiri
Tongkang Min-yak Berpeng-gerak Sendiri
Tongkang Min-yak Berpeng-gerak Sendiri
Tongkang Min-yak Berpeng-gerak Sendiri
Tongkang Min-yak Berpeng-gerak Sendiri
Tongkang Min-yak Nabati
Tongkang Min-yak Nabati
Tongkang Min-yak Nabati
246
560
616
534
7011179207
292429292929262617
2312
889
560614422007
542
2007
1908
2261
1869
1935
1861
1861
35.8x6.7x2.55
40.6x12x3.2
40.6x12x3.2
40.7x12x3.2
18x5.82x2.250x3.4x1.5527.45x7x3.232.1x7x3.412.2x4x2.213x4x1.612.2x4x2.212.2x4x2.212.2x4x2.212.2x4x2.20x4.6mx00x4.6x1.810.88x4x1.55
77.54x20.73x5.49
52.66x17.06x3.65
81.92x24.38x5.4958.52x18.29x3.6685x15.6x4.6
47.52x9.6x4.4
85x15.6x4.6
85.12x15x4.6
85.12x15.6x4.6
83.16x15.6x4.14
67.34x26.71x5.18
73.15x19.5x4.87
73.15x19.5x4.87
PT. Pelayaran Sakti Inti Makmur
DitjenPerhubunganDarat
DitjenPerhubunganDarat
DitjenPerhubunganDarat
PT.SamuderaEkspedisiAmanPT. Sahabat Samudra SejahteraPT. Tunas Terafulk LinesPT. Sillo Maritime PerdanaPT. Pelindo I (Persero)PT. Bintang Timur SamuderaPT. Pelindo I (Persero)PT. Pelindo I (Persero)PT. Pelindo I (Persero)PT. Pelindo I (Persero)PT. Pelindo II (Persero)PT. Pelindo II (Persero)PT. Pelindo II (Perseo) Cabang Pelabuhan PanjangPT. Pelayaran Kapuas Jatratama
PT. Pelayaran Josh Tirto
PT. Hafar Capitol NusantaraPT.DowellAnadrillSchlumbergerPT. Pelayaran Tirtacipta Mulyapersada
PT. Pelayaran Karbindo Alam Mulya
PT. Pelayaran Tirtacipta Mulyapersada
PT. Pelayaran Tirta Cipta Mulya Persada
PT. Pelayaran Tirtacipta Mulyapersada
PT.USDASerojaJaya
PT. Pelayaran Pandupasifik KarismarayaPT. Budi Samudra Perkasa
PT. Budi Samudra Perkasa
PT. Sukses Bahari Nusantara
PT. Mariana Bahagia
PT.DumasTanjungPerakShipyardPT. Mariana Bahagia
NilNilPT. Bintang Timur SamuderaPT. Vista Maritim IndonesiaNilPT. Bintang Timur SamuderaNilPT. Tesco IndomaritimNilNilPT.EkaMultiBahariPT.EkaMultiBahariPT.EkaMultiBahari
PT. Bandar Abadi Shipyard
PT. Karyasindo Samudra Biru ShipyardPT. Asl Shipyard IndonesiaPT. Nanindah Mutiara ShipyardNil
PT.Dok&PerkapalanKodjaBahari Galangan III
Nil
Nil
Nil
PT. Usda Seroja Jaya
PT. Bandar Abadi Shipyard
PT. Sumber Samudra Makmur
PT. Sumber Samudra Makmur
![Page 49: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/49.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
49 Annual Report 2011
Nama Kapal Jenis Kapal GT (Ton)
Dimension (m)
Pemilik Galangan
Mitra Bahari VIII
Metro01
SejahteraD12
BSI IV
Luminor1
Idecwood
KapuasJaya271
Luminor 2
Sumber Kencana V
Calvin II
CPT 2702
AquariusStar5
Persada2551
Persada2552
Miduk 03
CPL235
Sahoya
Ratu Juwita
Sabuk Nusantara 32
SabukNusantara31
SabukNusantara28
Sabuk Nusantara 27
Sabuk Nusantara 30
Bahari Jaya Lestari
RoyalPalmaXX
Tongkang Minyak Nabati
Tongkang Minyak Nabati
Tongkang Minyak Nabati
Tongkang Minyak Nabati
Tongkang Minyak Nabati
Tongkang Minyak Nabati
Tongkang Minyak Nabati
Tongkang Minyak Nabati
Tongkang Minyak Nabati
Tongkang Minyak Nabati
Tongkang Minyak
Tongkang Minyak
Tongkang Minyak
Tongkang Minyak
Tongkang Minyak
Tongkang Minyak
Tongkang Minyak
Tongkang Minyak
Kapal Penump-ang & Barang
Kapal Penump-ang & Barang
Kapal Penump-ang & Barang
Kapal Penump-ang & Barang
Kapal Penump-ang & Barang
Kapal Pendarat/Tangki Minyak
Tongkang Geladak & Tong-
kang Minyak Nabati
2578
2085
2150
2666
2150
290
2690
2150
2583
2666
2214
1042
2280
2087
2111
1961
2539
2290
1202
1202
1158
784
1202
627
2436
73.15x19.5x4.87
73.15x19.5x4.87
72.27x20.11x5.48
76.07x21.33x6.09
72.27x20.11x5.48
35.1x12.19x2.43
79x22.23x6.1
72.27x20.11x5.48
80.76x21.33x5.48
76.07x21.54x6.1
79.66x18.3x5.5
52.66x17.06x4.26
74.88x22x5.3
74.88x22x5.3
67.3x19.51x6.1
67.3x19.51x5.48
79x21.33x5.48
73.15x21.33x5.48
57.9x12x4
57.9x12x4
53.76x12x4.5
46.84x10.4x4.2
57.9x12x4
42.85x12x3.7
74.88x22x5.3
PT. Mitra Kencana Bahari
PT. Segara Transindo Mandiri
PT. Aneka Atlanticindo Nidy-atamaPT. Berjaya Samudera Indonesia
PT.MaximaLiners
PT. Idec Abadi Wood Industries
PT. Pelayaran Kapuas Jaya SamuderaPT.MaximaLiners
PT. Sumber Surya Kencana Inhu
PT. Pelayaran Pandupasifik KarismarayaPT. Cahaya Perdana Transalam
PT. Pelayaran Karya Pulau NusantaraPT. Persada Lines
PT. Persada Lines
PT. Mitsi Citra Mandiri
PT. Cindara Pratama Lines
PT.SinarAlamDutaPerdana
PT. Barokah Gemilang Perkasa
DitjenPerhubunganLaut
DitjenPerhubunganLaut
DitjenPerhubunganLaut
DitjenPerhubunganLaut
DitjenPerhubunganLaut
PT. Segara Laju Perkasa
PT.DeliMudaNusantara
PT. Sumber Samudra Makmur
PT. Bandar Abadi Shipyard
PT. Karyasindo Samudra Biru ShipyardPT. Bandar Abadi Shipyard
PT. Karyasindo Samudra Biru ShipyardPT. Karya Teknik Utama
PT. Bandar Abadi Shipyard
PT. Karyasindo Samudra Biru ShipyardPT. Sumber Samudra Makmur
PT. Bandar Abadi Shipyard
PT. Bandar Victory Shipyard
PT. Karya Teknik Utama
PT. Usda Seroja Jaya
PT. Usda Seroja Jaya
PT. Karya Teknik Utama
PT. Karya Teknik Utama
PT. Karya Teknik Utama
PT. Karya Teknik Utama
PT.DayaRadarUtama
PT.DayaRadarUtama
PT.DayaRadarUtama
PT.DayaRadarUtama
PT.DayaRadarUtama
PT. Caputra Mitra Sejati
Nil
![Page 50: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/50.jpg)
Annual Report 2011 Laporan Tahunan
50PT Biro Klasifikasi Indonesia (Persero)
Persetujuan GambarDrawing Approval
Padatahun2011,BKImenerimapermintaanuntukdraw-ing /plan approval yang terdiridari 1.922kontrakdan49.975gambar/perhitungan.Diantaranyaadalah28.837gambarkontruksilambung,14.685gambarpermesinan/listrikserta6.453gambar/perhitunganstatutoria.
In2011,BKIaccepted fordrawing /planapprovalconsisting of the 1.922 contract and 49. 975 draw-ings/ calculations. Among them are 28. 837 hullconstructiondrawings,and14.685machinery/elec-tricaldrawingsand6.453statutorydrawings/cal-culations.
Division 2007 2008 2009 2010 2011
Hull & MaterialMachinery&Electrical
Statutory
10.7028.9352.817
11.3929.5803.003
14.68211.2453.408
17.66612.3524.598
28.83714.6856.453
Total 22.454 23.975 29.335 34.616 49.975
![Page 51: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/51.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
51 Annual Report 2011
Aktifitas Survey KlasifikasiClass Survey Activities
Dalampelaksanaan survey di lapangan,BKImenerima17.233permintaansurveyyangterdiridari1.763surveydalamrangkapenerimaankelasdan15.470surveydalamrangka mempertahankan kelas. Perincian jenis survey yang dilakukan adalah sebagai berikut :
In implementing field survey,BKI received17.233applicationforsurveyconsistingof1.763surveysforadmissiontoclassand15.470surveysformaintain-ing of class. The breakdown of kind of survey carried out,are as follows:
Kind Survey 2007 2008 2009 2010 2011
Renewal SurveyAnnual Survey
Intermediate SurveyDockingSurvey
Shaft Propeller SurveyBoiler Survey
Automation SurveyContinuous Survey
ClassExtensionSurveyCondition Survey
New Building Admission Class SurveyExistingShipAdmissionClassSurvey
Re-class Survey
9213.619618
2.5141.11420825489238
4.227178753100
8823.576579
2.3001.155181
20354227
5.48425862168
8783.660748
2.4391.15816717284202
5.824219735123
9133.855
7662.5251.216180
20231
6.807320430759172
1.0284.409831
2.7861.22618317
3694.346275695850218
Total 15.004 15.705 16.454 18.195 17.233
![Page 52: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/52.jpg)
Annual Report 2011 Laporan Tahunan
52PT Biro Klasifikasi Indonesia (Persero)
Aktivitas Jasa IndustriIndustrial Services Activities
Sebagai bagian dari survey klasifikasi kapal, BKI melak-sanakan pengawasan pada sistem mutu dari perusahaan manufacture dan jasa yang berhubungan dengan pem-bangunan kapal. Pengawasan pada sistem mutu tersebut dilakukan untuk memastikan bahwa produk maupun jasa yang disuplai oleh perusahaan yang terlibat dalam klasifikasi kapal memiliki konsistensi mutu sesuai den-gan spesifikasi yang disyaratkan Rules.
Perusahaan yang telah mengajukan permohonan untuk mendapatkan pesetujuan sebagai pembuat atau pelaksana jasa akan di periksa berdasarkan peraturan Biro Klasifi-kasi Indonesia dan peraturan standart mutu. Assessment dilakukan pada Sistem Manajemen Mutu, Standar Mutu, Kontrol Mutu, Rencana Mutu dan Prosedur Kerja yang dirancang oleh perusahaan pemohon. Bila dari hasil as-sessment dinyatakan bahwa perusahaan pemohon telah mampu untuk mempertahankan mutu secara konsisten sesuai dengan peraturan Biro Klasifikasi Indonesia maka akan diterbitkan Sertifikat Persetujuan.
Untuk mengawasi konsistensi standar mutu perusahaan yang telah mendapatkan Sertifikat Persetujuan, dilaku-kan pemeriksaan secara periodik pada sistem mutu dan dokumentasi catatan mutu perusahaan.
As a part of the ship classification survey, BKI car-ried out supervision on quality system of manufac-turers and service companies related to ship build-ing. Supervision of the quality system is undertaken to ensure that the products and services supplied by companies involved in the classification of the vessel has the consistency of quality in accordance with the specifications required by Rules.
Companies that have applied to get approval as a service maker or executor will be examined in ac-cordance to BKI rules and quality standard regula-tion. Assessment carried out in accordance to Qual-ity management System, Quality Standard, Quality Control, Quality Plans and Work Procedures design by the applicant company. When the assessment ac-cepted and the applicant company able to maintain the consistency of the quality in accordance to BKI regulation, then Certificate of Approval will be is-sued.
To monitor the consistency of quality standards of the approved company, periodical checks on the quality system and documentation of quality records will be conducted.
![Page 53: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/53.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
53 Annual Report 2011
Annual Report 2011 Laporan Tahunan
![Page 54: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/54.jpg)
Annual Report 2011 Laporan Tahunan
54PT Biro Klasifikasi Indonesia (Persero)
Survey StatutoriaStatutory Survey
BKI sebagai Badan Klasifikasi telah memenuhi per-syaratan teknis dan kriteria sesuai dengan IMO Resolusi A.739(18)danA.789(19)sebagaiRecognizedOrganiza-tion (RO) untuk ditunjuk melaksanakan survey kapal-kapal berbendera Indonesia atas nama Pemerintah Indo-nesiacqDitjenPerhubunganLaut.
BKI telah memiliki jumlah safety auditor 71 yangberkualifikasi untuk melaksanakan audit ISM Code dan 80 auditor untuk melaksanakan audit ISPS Code. BKIjuga menerbitkan Register ISM Code & ISPS Code yang dipublikasikan melalui media cetak maupun akses mela-lui website BKI.
As a Classification Society BKI has comply with techni-cal requirements and criteria as a Recognized Organi-zation(RO)accordingtoIMOResolution A.739 (18)andA.789(19)tobeappointedtocarryoutsurveysIn-donesian-flagged vessels on behalf of the Government of Indonesia cq. Directorate General of Sea Transportation.
BKIhashad71ofqualifiedsafetyauditorstocarryoutISMCodeauditand80toaudittheISPSCode.BKI has also publishes the Register of ISM Code and ISPS Code, published through print media as well as access via BKI website.
Audit Activity 2007 2008 2009 2010 20111. ISMCode–InitialAudit2. ISMCode–AnnualAudit3. ISMCode–IntermediateAudit4. ISMCode–RenewalAudit5. ISMCode–DOCissued6. ISMCode–SMCIssued7. ISPSCode–InitialAudit8. ISPSCode–IntermediateAudit9. ISPSCode–ISSCissued10.LoadLine11.CAS12.AntiFoulingSystem13.SewageApproval14.FireControl15.IAPP(MarpolAnnexVI)16.ISPP(MarpolAnnexII)17.SMPEP(MarpolAnnexII)
1098515319345251
349141
--------
949066182
37342
323439
--------
18584101183412011071490
6.191952-441
2121051996178
300961488
6.5968522141
1621041658142
203542668
5.5309622141
Total 15.004 15.705 16.454 18.195 17.233
![Page 55: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/55.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
55 Annual Report 2011
Annual Report 2011 Laporan Tahunan
![Page 56: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/56.jpg)
Annual Report 2011 Laporan Tahunan
56PT Biro Klasifikasi Indonesia (Persero)
Otorisasi StatutoriaStatutory Authorization
Hingga tahun 2011, otorisasi yang telah dipercayakankepada BKI dibidang klasifikasi kapal dan statutoria adalah :• ObligationofIndonesianflaggedshipstohaveclas-
sification certificate from BKI.• Survey Authorization to survey of loadline marks
and issue loadline certificates (IPLT & PGMI) for In-donesian flagged ships.
• SurveyAuthorizationandCertificationforContain-er.
• Survey Authorization and Certification of SafetyConstruction,MarpolAnnex I& II andFitnessofChemical Carrier & Gas Carrier in Bulk for Indone-sianflaggedshipsatatonnagemorethan500GT.
• AuditAuthorizationandCertificationofISMCodefor Indonesian flagged ships.
• AsaRecognizedSecurityOrganization(RSO),con-ducting audit and certification of ISPS Code for In-donesian flagged ships.
• SurveyAuthorizationandCertificationofAnnexVIMarpol73/78forIndonesianflaggedships.
• SurveyAuthorizationandCertificationofConditionAssessment Scheme (CAS) in accordance with An-nexIMarpol73/78forIndonesianflaggedships.
• Statutory Authorization from MMA (MongoliaMaritime Administration)
Sedangkan otorisasi yang telah dipercayakan kepada BKI di bidang minyak & gas, panas bumi, kelistrikan dan ketenagakerjaan adalah :
Until2011,theauthorizationentrustedtoBKIforshipclassification and statutory are :• ObligationofIndonesianflaggedshipstohaveclas-
sification certificate from BKI.• SurveyAuthorization to survey of loadlinemarks
and issue loadline certificates (IPLT & PGMI) for Indonesian flagged ships.
• Survey Authorization and Certification for Con-tainer.
• Survey Authorization and Certification of SafetyConstruction, Marpol Annex I & II and Fitness of Chemical Carrier & Gas Carrier in Bulk for Indo-nesianflaggedshipsatatonnagemorethan500GT.
• AuditAuthorizationandCertificationofISMCodefor Indonesian flagged ships.
• AsaRecognizedSecurityOrganization(RSO),con-ducting audit and certification of ISPS Code for In-donesian flagged ships.
• Survey Authorization and Certification of AnnexVIMarpol73/78forIndonesianflaggedships.
• Survey Authorization and Certification of Condi-tion Assessment Scheme (CAS) in accordance with AnnexIMarpol73/78forIndonesianflaggedships.
• Statutory Authorization from MMA (MongoliaMaritime Administration)
While the authorization entrusted to the BKI in oil & gas, geothermal, electricity and man power sectors are:
![Page 57: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/57.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
57 Annual Report 2011
• TechnicalInspectionofFeasibilityofCombinedFa-cilityCertificatefromDirectorateGeneralofOilandGas.
• Technical Inspection of Crane from DirectorateGeneral of Oil and Gas.
• TechnicalInspectionofPressureVesselfromDirec-torate General of Oil and Gas.
• Technical Inspection of Pipeline from DirectorateGeneral of Oil and Gas.
• TechnicalInspectionofPlatformConstructionfromDirectorateGeneralofOilandGas.
• Technical InspectionofElectricalEquipment fromDirectorateGeneralofOilandGas.
• Technical Inspection of Rotating Equipment fromDirectorateGeneralofOilandGas.
• TechnicalInspectionofStorageTankfromDirecto-rate General of Oil and Gas.
• Inspection and Testing of Crane fromMinistry ofManpower and Transmigration.
• InspectionandTestingofBoilerandPressureVesselfrom Ministry of Manpower and Transmigration.
• InspectionandTestingofElectricEquipmentfromMinistry of Manpower and Transmigration.
• BKILaboratoryforNDTandDTofmaterial,equip-ment relating to boiler and pressure vessel from Ministry of Manpower and Transmigration.
• InspectionandTestingofCrane,PressureVesselandBoileronboardshipandatHarbour fromDirecto-rate General of Sea Transportation.
• InspectionofHelideckfromDirectorateGeneralofAir Transportation.
• SertifikatVerifikasiTempatUjiKompetensiLasdariLembaga Sertifikasi Profesi Las.
• Lembaga Inspeksi Tipe A dari Komite AkreditasiNasional.
• Laboratorium Penguji dari Komite Akreditasi Na-sional.
• Penunjukansebagailembagainspeksiteknikdalamrangka pemeriksaan dan pengujian instalasi tenaga listrik dari Kementrian ESDMDirektorat JenderalListrikdanPemanfaatanEnergi.
• Penunjukansebagaibadanauditsistemmanajemenkeselamatan dan kesehatan kerja dariDepartemenTenaga Kerja dan Transmigrasi.
• Penunjukanpelaksanaanpengujian,inspeksiteknikdan sertifikasi di lingkungan proyek-proyek per-
• TechnicalInspectionofFeasibilityofCombinedFa-cility Certificate from Directorate General of Oil and Gas.
• Technical Inspection of Crane from DirectorateGeneral of Oil and Gas.
• TechnicalInspectionofPressureVesselfromDirec-torate General of Oil and Gas.
• Technical Inspection of Pipeline from DirectorateGeneral of Oil and Gas.
• TechnicalInspectionofConstructionPlatformfromDirectorate General of Oil and Gas.
• Technical Inspection of Electrical Equipment fromDirectorate General of Oil and Gas.
• Technical Inspection of Rotating Equipment fromDirectorate General of Oil and Gas.
• TechnicalInspectionofStorageTanksfromDirecto-rate General of Oil and Gas.
• Inspection and Testing of Crane fromMinistry ofManpower and Transmigration.
• InspectionandTestingofBoilerandPressureVesselfrom Ministry of Manpower and Transmigration.
• InspectionandTestingofElectricEquipment fromMinistry of Manpower and Transmigration.
• BKI Laboratory for NDT and DT of material,equipment relating to boiler and pressure vessel from Ministry of Manpower and Transmigration.
• InspectionandTestingofCrane,BoilerandPressureVessel onboard ship and at harbour from Directo-rate General of Sea Transportation.
• InspectionofHelideckfromDirectorateGeneralofAir Transportation.
• Test Place of Verification Certificate of WeldingCompetency from Lembaga Sertifikasi Profesi Las.
• TypeAInspectionBodyoftheNationalAccredita-tion Committee.
• Testing Laboratory of the National AccreditationCommittee.
• Designationasaninspectiontechniqueinordertocheck the installation and testing of electrical power fromtheMinistryofEnergyandMineralResourcesDirectorateGeneralofElectricityandEnergyUtili-zation.
• The appointment of a safety management systemaudit bodies and health from the Ministry of Man-power and Transmigration.
• Theappointmentoftheimplementationofthetest-
![Page 58: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/58.jpg)
Annual Report 2011 Laporan Tahunan
58PT Biro Klasifikasi Indonesia (Persero)
tambangan mineral dan batu bara dari Kementrian ESDM-DitjenMinerbapabum.
• Penunjukan sebagai pelaksana pemeriksaan danpengujian menara telekomunikasi di wilayah kota Pekanbaru dari Dinas Perhubungan, Komunikasidan Informatika Kota Pekanbaru.
ing, inspection and certification in environmental engineering projects and coalmining industries oftheMinistryofESDM-DGMinerbapabum.
• Theappointmentas the executorof the inspectionand testing of telecommunications towers in the area of Pekanbaru from the Dinas Perhubungan, Komunikasi dan Informatika Pekanbaru .
![Page 59: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/59.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
59 Annual Report 2011
Konsultansi & SupervisiConsultancy & Supervision
Inspeksi & Sertifikasi BKI juga memberikan jasa inspeksi dan sertifikasi terha-dap industri di lingkungan minyak dan gas serta ketena-gakerjaan. BKI dipercaya untuk melakukan inspeksi dan sertifikasi berbagai proyek / pekerjaan, meliputi inspeksi dan sertifikasi atas nama DitjenMigas, meliputi SKPPPressure Vessel, Crane, Rotating Equipment, ElectricalEquipment,Pipeline,StorageTank,SKPI.
Inspection & Certification BKI also provide inspection and certification services to industry in the oil and gas as well as employment. BKI trusted to do the inspection and certification of variousprojects , includinginspectionandcertifica-tion on behalf of DitjenMIGAS, including SKPP,PressureVessel,Crane,RotatingEquipment,Electri-calEquipment,Pipeline,StorageTank,SKPI.
RotatingEquipmentElectricalEquipmentStorage Tank Pressure Safety Valve WPS And Welder Test SKPI Pressure Vessel Crane Pipeline PJIT RigPengujianPeralatanRigging/LiftingDeviceNDTSIO Crane
2222011
642
40031
Jumlah 75
Sektor Mineral Batu Bara Panas Bumi
![Page 60: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/60.jpg)
Annual Report 2011 Laporan Tahunan
60PT Biro Klasifikasi Indonesia (Persero)
Cementing Test Alat Angkat Angkut Rigging/Lifting Gear Penangkal Petir GasEmisiSurface TestingPSV (Katup Pengaman) SIO Crane VSDTransportSkidContainerMetalBoxPengujian Cathodic ProtectionInspeksi Menara Telkom Inspeksi Peralatan WTUVerifikasiCapaianTKDNInspeksi Tubing Casing (Pipa Bor) Inspeksi Busket (Jaring/Metal(Logam)) Inspeksi Welding Machine (Pengelasan Machine) Inspeksi Skid And Spreader Bar (Alat Bantu Angkat Barang) InitialInspectionofBoxCrossoverThreadPeriodical Inspection Of Pressure Gauge/Mooring System InitialInspectionof8¾ACMEBowenBoxSupervisi Repair Tank (Tangki Timbun) Sertifikasi Tangki Transport Sertifikasi Pressure VesselSertifikasi Mesin BorSertifikasi Pompa, Kompresor & PenggeraknyaJasa Inspeksi Peralatan KilangRentalHolidayDetector&OperatorWelder QualificationWelding Procedure SpecificationJetty(DermagaKecil)HarusAdaAMDALManualSystemISM(DOC&SOC)Standard Operating ProcedureJasa Konsultasi ISPS Code
4138231
341
24121100120010
4261415
2200000000000
Jumlah 603
HelideckAlat Angkat Angkut (SKB)
052
Jumlah 52
Sertifikasi BKI
Sektor Perhubungan
![Page 61: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/61.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
61 Annual Report 2011
SKPI PlatformPressure Vessel Crane Pipeline RotatingEquipmentElectricalEquipmentStorage TankPressure Safety ValveWPS & Welder TestSurat Izin Memasuki Operasi MigasPJIT RigNDTRiggingSIO Crane
43417111513141511
070000
Jumlah 240
NDTPressureVesselDanBoilerAlat Angkat Angkut Pipeline RotatingEquipmentElectricalEquipmentStorage Tank Pressure Safety Valve WPS & Welder TestNDTFireSystemSMK 3SIO Crane
221110
0818
3214400
Jumlah 173
Sektor Migas
Sektor Migas
![Page 62: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/62.jpg)
Annual Report 2011 Laporan Tahunan
62PT Biro Klasifikasi Indonesia (Persero)
Pengujian & LaboratoriumTesting & Laboratory
Di bidang pengujian BKI telahmelaksanakanDestruc-tiveTest(DT)danNonDestructiveTest(NDT)dengankegiatan, meliputi Radiography, Ultrasonic Test, Magnet-icParticle Inspection,DyePenetrant,UjiTarikdanUjiTakik.
In case of testing ,BKI has implemented Destructive Test (DT) and Non Destructive Test (NDT) by Ra-diography, Ultrasonic Test, Magnetic Particle Inspec-tion, Dye Penetrant, Pull Test and Notch Test.
Wire Rope Test GasFreeTestVibration Sound Test HolidayDetectorTestCrackDepthTestDyePenetrantTestMagnetic Particle Test Ultrasonic Test Radiography Test Tensile Test Bend Test Hardness Test Macro Test Impact Test Chemical Composition Analysist NDT(MPI)NDT(DPT)Load Test Hydrotest Merger Test DT
26530162561561365441592815
31531
40472
23383504
0
Junlah 3715
PENGUJIAN & LABORATORIUMTesting & Laboratory
![Page 63: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/63.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
63 Annual Report 2011
Rekayasa TeknikEngineeringDesign
Untuk kegiatan rekayasa teknik, BKI melakukan perhi-tungan teknik dan desain apraisal. Proyek yang ditangani adalah :
For engineering design, BKI performs engineering calculationsanddesignAppraisal.Projectshandledare:
Rekayasa Teknik Volume Kegiatan
DesignAppraisalAndSupervisionMooringSystemDesignAppraisalAndSupervisionPlatformShipDesignConsultant RKS & Rab QC Crane
Jumlah
3120
6
![Page 64: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/64.jpg)
Annual Report 2011 Laporan Tahunan
64PT Biro Klasifikasi Indonesia (Persero)
Inspeksi & Supervisi MaritimMarine Inspection & Supervision
Untuk kegiatan inspeksi dan supervisi marine, BKI telah menangani Survey Kondisi (pemeriksaan propeler, in-ventarisasi sistem perawatan kapal, evaluasi hasil peker-jaan perbaikan kapal), Perhitungan stabilitas & trim ka-pal, Megger Test, Bollard Pull Test, Vibration & Noise Level Test, Kalibrasi tangki, On/Off Hire Survey, Pem-buatan gambar teknik, Penyusunan Hatch Cover Plan, Penyusunan Cargo Securing Manual dan Penyusunan Manual ISM Code.
In maritime inspection and supervision activities, BKI has handled Condition Survey (propeller in-spection, an inventory of ship maintenance system, ship repair evaluation results), trim & stability cal-culation , Megger Test, Bollard Pull Test, Vibration & Noise Level Test, calibration tank, On / Off Hire Survey, technical drawings, Hatch Cover Plan, Cargo Securing Manual and ISM Code Manual.
![Page 65: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/65.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
65 Annual Report 2011
New Building SupervisionShip Repair And Modification Supervision Ship Condition Survey Insurance Survey On And Off Hire Survey Tank Calibration Survey Towing And Lashing Survey Stability Calculation FloatingObjectInspectionDraughtSurveyFeasibilityStudyInMarineIndustryEnvironmentStudyInspection And Consultancy Of Land Transportation ModificationShipDrawingTechnical Audit Of Ship Performance Insulation Resistance Measurement/Megger Test Noise Level Measurement Vibration Measurement Phase Sequence Measurement Speed/RPM Measurement Bollard Pull Test Pengujian Penambat Kapal/Pengikat KapalTowing Tank (Tempat Pengujian Kapal) Kalibrasi Tangki Muat Kapal (Isi Muatan Tangkinya) Ship Speed Trial (Kapal Cepat) Ship Particulars (Pendataan Khusus Kapal)
1312380
202
1701229817501
1353
400920141122
00
Junlah 1508
Konsultansi,Supervisi & MarineConsultancy, Supervision and Marine
![Page 66: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/66.jpg)
Annual Report 2011 Laporan Tahunan
66PT Biro Klasifikasi Indonesia (Persero)
Pelatihan PublikPublic Training
BKI dalam setiap tahunnya juga menyelenggarakan pelatihan teknik, baik dalam bentuk inhouse training maupun public training, di antaranya :
BKI also routinely organizes technical training, both in-house training and public training. The training are :
Welding Inspector Marine Surveyor Crane Operator Planned Maintenance System Internal Auditor ISM-Code Radiography Operator Ship Automation Survey DraughtSurveyOn And Off Hire Survey DamageAndRepairSurveyIndustrial And Marine Stagging Ship Security Officer Towing And Lashing Ship Condition Rigging And Signalman Company Security Officer (ISPS-Code) ISPSPFSOISPS CSOIMDGCodeDesignatedPersonAshoreSMK3/HSE
5750101000010010
2410000
Junlah 55
Sewa PeralatanSewa Personil
10214
Junlah 116
Pendidikan Dan PelatihanEducationandTraining
Umum
![Page 67: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/67.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
67 Annual Report 2011
Annual Report 2011 Laporan Tahunan
![Page 68: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/68.jpg)
Annual Report 2011 Laporan Tahunan
68PT Biro Klasifikasi Indonesia (Persero)
Penelitian & PengembanganResearch & Development
Sesuai dengan misi yang diemban, BKI juga melakukan riset dan pengembangan terutama untuk pengembangan Rules & Regulation sebagai standar teknis kapal serta mempublikasikannya. Kegiatan penelitian dan pengem-bangan Rules & Regulation yang telah dilaksanakan ta-hun2011sebagaiberikut:a. Rules & Regulation BKI yang telah selesai meliputi :
• RulesForClassificationSurveys,VolumeI–Edi-tion2011
• Peraturan Klasifikasi and Survei, Jilid I – Edisi2011
• RulesforDinamicsPositioningSystems• RulesForTheEnvironmentalServiceSystems• GuidelinesForMachineryConditionMonitoring• Rules For Electrical InstallationVolume IV Edi-
tion2011• GuidelinesfortheConstructionandClassification
/CertificationofFloatingProduction,StorageandOffloadingUnitEdition2011
• Rules forClassifications andContructionofAff-shore Installation
• RulesForTheClassificationandSurveys,Vol.1–Edition2011
• RulesforStructures,Vol.2–Edition2011• RulesforMachineryInstallationsVol.4–Edition
2011• Rules forElectricalInstallations,Vol.5–Edition
2011• Rules forMobileOffshoreUnit,Vol. 6 –Edition
2011
In accordance with its mission statement, BKI also conducted research and development primarily for Rules & Regulation development as technical stand-ard of ships and also published it. Activity of research & development of Rules & Regulation which has donein2011asfollows:a. Rules & Regulation BKI yang telah selesai meli-
puti :• Rules ForClassification Surveys,Volume I –
Edition2011• PeraturanKlasifikasiandSurvei,JilidI–Edi-
si2011• RulesforDinamicsPositioningSystems• RulesForTheEnvironmentalServiceSystems• Guidelines For Machinery Condition Moni-
toring• Rules For Electrical Installation Volume IV
Edition2011• Guidelines for theConstructionandClassifi-
cation / Certification of Floating Production, StorageandOffloadingUnitEdition2011
• Rules for Classifications and Contruction ofAffshore Installation
• RulesForTheClassificationandSurveys,Vol.1–Edition2011
• RulesforStructures,Vol.2–Edition2011• RulesforMachineryInstallationsVol.4–Edi-
tion2011• RulesforElectricalInstallations,Vol.5–Edi-
tion2011
![Page 69: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/69.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
69 Annual Report 2011
• RulesforFixedOffshoreInstallations,Vol.7–Edi-tion2011
b. Melakukan presentasi bersama (joint presentation) BKI dan Korean Register (KR) terhadap peraturan klasifikasi & statutoria yang terbaru kepada para pemakai jasa BKI di Jakarta.
c. Melakukan pengkajian bersama antara BKI dan NK terhadapaplikasiRulesFPSO/FSO.
d. Terlibat dalam Working Group antar anggota aso-siasi Asian Classification Society (ACS), meliputi WG WG Port State Control (PSC), WG Quality, WG Risk BasedDesign(RBD),WGMachinerySeaworthiness,WG Ship Recycle (SR), WG Goal Based Standard (GBS), WG Ballast Water Management (BWM) dan WG Green House Gas (GHG).
HinggaposisiakhirDesember2011,BKItelahmenerbit-kan sejumlah Rules & Regulation, yaitu:1. RulesforClassificationandSurveys(VolumeI-2007);2. RulesforHull(VolumeII-edition2006);3. RulesforMachineryInstallation(VolumeIII-Edition
2007);4. RulesforElectricalInstallations(VolumeIV-Edition
2007);5. RulesforMaterials(VolumeV-Edition2006);6. RulesforWelding(VolumeVI-Edition2004);7. RulesforAutomation(VolumeVII-Edition2007);8. Rules for Refrigerating Installations (Volume VIII-
Edition2001);9. Rules for Ships Carrying Liquefied Gases In Bulk
(VolumeIX-Edition2005);10.Rules for Ships Carrying Dangerous Chemicals In
Bulk(VolumeX-Edition2002);11.Rules for Inland Waterway vessels Chapter 1-Hull
Construction(Edition1996);12.RulesforInlandWaterwayvesselsChapter2-Machin-
eryInstallations(Edition1996);13.RulesforInlandWaterwayvesselsChapter3-Electri-
calInstallation(Edition1996);14.RulesforHighSpeedVessels(Edition1996);15.Rules forFibreglassReinforcedPlasticVessels (Edi-
tion1996);16.RulesforWoodenShip(Edition1996);17.RulesforMobileOffshoreDrillingUnitsandSpecial
PurposeUnits(Edition1999);
• Rules forMobileOffshoreUnit,Vol.6–Edi-tion2011
• RulesforFixedOffshoreInstallations,Vol.7–Edition2011
1. RulesforClassificationandSurveys(VolumeI-2007);2. Rules for Hull (Volume II- edition 2006);3. RulesforMachineryInstallation(VolumeIII-Edition
2007);4. RulesforElectricalInstallations(VolumeIV-Edition
2007);5. RulesforMaterials(VolumeV-Edition2006);6. RulesforWelding(VolumeVI-Edition2004);7. RulesforAutomation(VolumeVII-Edition2007);8. Rules for Refrigerating Installations (Volume VIII-
Edition2001);9. Rules for Ships Carrying Liquefied Gases In Bulk
(VolumeIX-Edition2005);10.Rules for Ships Carrying Dangerous Chemicals In
Bulk(VolumeX-Edition2002);11.Rules for Inland Waterway vessels Chapter 1-Hull
Construction(Edition1996);12.Rules for Inland Waterway vessels Chapter 2-Ma-
chineryInstallations(Edition1996);13.RulesforInlandWaterwayvesselsChapter3-Electri-
calInstallation(Edition1996);14.RulesforHighSpeedVessels(Edition1996);15.Rules for Fibreglass Reinforced Plastic Vessels (Edi-
tion1996);16.RulesforWoodenShip(Edition1996);17.RulesforMobileOffshoreDrillingUnitsandSpecial
PurposeUnits(Edition1999);
![Page 70: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/70.jpg)
Annual Report 2011 Laporan Tahunan
70PT Biro Klasifikasi Indonesia (Persero)
18.RulesforStowageandLashingofContainers(Edition1999);
19.Rules for Classification and Construction of HighSpeedCraft(Edition2000);
20.RulesforOffshoreMooringChains(Edition2000);21.RulesforMooringandLoadingInstallations(Edition
2002);22.RulesforTheClassificationandConstructionofOff-
shore Installations (Volume1 :RulesForClassifica-tionandSurvey-Edition2002);
23.RulesforTheClassificationandConstructionofOff-shore Installations (Volume2 :RulesForStructuresMachineryInstallations-Edition2002);
24.Rules for The Classification and Construction ofOffshoreInstallations(Volume3:RulesForSpecificTypeofUnitsandEquipment-Edition2002);
25.RulesforTheClassificationandConstructionofOff-shoreInstallations(Volume4:RulesForMachineryInstallations-Edition2002);
26.RulesforTheClassificationandConstructionofOff-shore Installations (Volume 5 : Rules For ElectricalInstallations-Edition2002);
27.RulesforFloatingDocks(Edition2002);28.RulesforFishingVessels(Edition2003);29.RulesforOilRecoveryVessel(Edition2005);30.RulesforNonMetalicMaterial(Edition2006);31.CommonStructuralRulesforTanker;32.CommonStructuralRulesforBulkCarrier;33. Rules for Approval of Manufacturers and Service Sup-
pliers.
List of BKI’s Regulation:1. RegulationforTheTestingofEnginesProducedinSe-
ries(Editionof1996);2. Regulation for The Calculation of Diesel Engines
Crankshaft(Editionof1996);3. RegulationforTheSeatingofDieselEnginesInstalla-
tions(Editionof1996);4. RegulationforTheDesign,ConstructionandTesting
ofPumps(Editionof1996);5. RegulationforEquipmentonTheFireFightingShips
(Editionof1996);6. RegulationforConstruction,EquipmentandTesting
ofClosedFuelOverflowSystem(Editionof1996);7. Regulation for The Installation and Ventilation of
Storage Batteries and The Construction of Battery
18.RulesforStowageandLashingofContainers(Edition1999);
19.Rules for Classification and Construction of HighSpeedCraft(Edition2000);
20.RulesforOffshoreMooringChains(Edition2000);21.RulesforMooringandLoadingInstallations(Edition
2002);22. Rules for The Classification and Construction of Off-
shore Installations (Volume1 :RulesForClassifica-tionandSurvey-Edition2002);
23. Rules for The Classification and Construction of Off-shore Installations (Volume 2 : Rules For Structures MachineryInstallations-Edition2002);
24. Rules for The Classification and Construction of Off-shore Installations (Volume 3 : Rules For Specific Type ofUnitsandEquipment-Edition2002);
25.RulesforTheClassificationandConstructionofOff-shore Installations (Volume 4 : Rules For Machinery Installations-Edition2002);
26. Rules for The Classification and Construction of Off-shore Installations (Volume 5 : Rules For ElectricalInstallations-Edition2002);
27.RulesforFloatingDocks(Edition2002);28.RulesforFishingVessels(Edition2003);29.RulesforOilRecoveryVessel(Edition2005);30.RulesforNonMetalicMaterial(Edition2006);31.CommonStructuralRulesforTanker;32. Common Structural Rules for Bulk Carrier;33. Rules for Approval of Manufacturers and Service
Suppliers.
List of BKI’s Regulation:1. Regulation forThe Testing of Engines Produced in
Series(Editionof1996);2. Regulation for The Calculation of Diesel Engines
Crankshaft(Editionof1996);3. RegulationforTheSeatingofDieselEnginesInstalla-
tions(Editionof1996);4. Regulation for The Design, Construction and Testing
ofPumps(Editionof1996);5. RegulationforEquipmentonTheFireFightingShips
(Editionof1996);6. RegulationforConstruction,EquipmentandTesting
ofClosedFuelOverflowSystem(Editionof1996);7. Regulation for The Installation and Ventilation of
Storage Batteries and The Construction of Battery
![Page 71: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/71.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
71 Annual Report 2011
Chargers(Editionof1996);8. Regulation for Electromagnetic Compatibility of
ElectricalEquipment(Editionof1996);9. RegulationforLighting(Editionof1996);10.Regulation forVariableFrequencyShipsMainsOp-
eration (Variable Frequency Operation (Edition of1996);
11.Regulation forTheUseofComputerandComputerSystems(Editionof1996);
12.RegulationforThePerformanceofTypeTest,Part1:Procedure(Editionof2002);
13.RegulationforThePerformanceofTypeTest,Part2:TestRequirementsForElectrical/ElectronicEquip-ment,ComputerandPeripheral(Editionof2002);
14.RegulationforThePerformanceofTypeTest,Part3:TestRequirementsForSealingSystemsofBulkheadandDeckPenetrations(Editionof2002);
15.RegulationforThePerformanceofTypeTests,Part4:TestRequirementsforElectricalMachinery(Editionof2002);
16.RegulationforThePerformanceofTypeTests,Part5: Test Requirements for Mechanical Components and Equipment(Editionof2004);
17.Regulation for Mass Produced Engines (Edition of1996);
18.RegulationforTheConstructionandSurveyofLift-ingAppliances(Editionof1998);
19.Regulation for Construction, Repair and Testing ofFreightContainers(Editionof1999);
20.RegulationforAssessmentandRepairsofDefectsonPropellers(Editionof2000);
21.RegulationforConstructionsandTestingofTowingGears(Editionof2000);
22.Procedure&Guidelines forTheISM-Code(Edition2002)
23.RegulationforTheLifeSavingLaunchingAppliances(Editionof2001);
24.GuidelinesforOceanTowage(Editionof2001);25.GuidelinesforTheExplosionProtectionofElectrical
Equipment(Editionof2001);26.GuidelinesforSeaTrialsofMotorVessels(Editionof
2002-English&Indonesian);27.Regulation forTheInspectionofAnchorChainCa-
bles(Editionof2002);28.Regulations forRedundant Propulsion and Steering
Systems(Edition2002);
Chargers(Editionof1996);8. Regulation for Electromagnetic Compatibility of
ElectricalEquipment(Editionof1996);9. RegulationforLighting(Editionof1996);10.RegulationforVariableFrequencyShipsMainsOp-
eration (Variable Frequency Operation (Edition of1996);
11.RegulationforTheUseofComputerandComputerSystems(Editionof1996);
12.RegulationforThePerformanceofTypeTest,Part1:Procedure(Editionof2002);
13.RegulationforThePerformanceofTypeTest,Part2:TestRequirementsForElectrical/ElectronicEquip-ment,ComputerandPeripheral(Editionof2002);
14.RegulationforThePerformanceofTypeTest,Part3: Test Requirements For Sealing Systems of Bulkhead andDeckPenetrations(Editionof2002);
15.Regulation forThePerformanceofTypeTests,Part4:TestRequirementsforElectricalMachinery(Edi-tion of 2002);
16.RegulationforThePerformanceofTypeTests,Part5: Test Requirements for Mechanical Components and Equipment(Editionof2004);
17.Regulation for Mass Produced Engines (Edition of1996);
18.RegulationforTheConstructionandSurveyofLift-ingAppliances(Editionof1998);
19.Regulation for Construction, Repair andTesting ofFreightContainers(Editionof1999);
20. Regulation for Assessment and Repairs of Defects on Propellers(Editionof2000);
21.RegulationforConstructionsandTestingofTowingGears(Editionof2000);
22.Procedure&Guidelines forTheISM-Code(Edition2002)
23. Regulation for The Life Saving Launching Appliances (Editionof2001);
24.GuidelinesforOceanTowage(Editionof2001);25.GuidelinesforTheExplosionProtectionofElectrical
Equipment(Editionof2001);26.GuidelinesforSeaTrialsofMotorVessels(Editionof
2002-English&Indonesian);27. Regulation for The Inspection of Anchor Chain Ca-
bles(Editionof2002);28.Regulations forRedundantPropulsionandSteering
Systems(Edition2002);
![Page 72: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/72.jpg)
Annual Report 2011 Laporan Tahunan
72PT Biro Klasifikasi Indonesia (Persero)
29.GuidelinesforIncliningTestofShips(Edition2003);30.RegulationforTheClassificationandConstrustionof
FibreReinforcedPlasticWorkboat(Edition2003);31.RegulationforVentilationSystemsonBeardSeagoing
Ships(Edition2004);32.RegulationforTheCorrosionProtectionandCoating
Systems(Edition2004);33.RegulationforTheBridgeDesignonSeagoingShips
OneManConsole(Edition2004);34.GuidelinesforTheCarriageofRefrigeratedContain-
ersonBoardShips(Edition2004);35.RegulationforAnalysisTechnique,StrengthandSta-
bility(Editionof2005);36.Guidelines forThe Preparation ofDamage Stability
CalculationandDamageControlDocumentationOnBoard(Editionof2005);
37.Procedure & Guideline for ISPS Code (Edition of2004);
38.GuidelinesforThicknessMeasurementsofship’splate(Editionof2005);
39. Guidelines for Condition Assessment Scheme (CAS)(Editionof2006);
40. Guidelines for Classification & Construction of Wing-InGroundCraft(WIG-Craft)(Edition2006);
41.Guidance for ImplementationMarpol 73/78 AnnexVI(Edition2006).
29.GuidelinesforIncliningTestofShips(Edition2003);30. Regulation for The Classification and Construstion of
FibreReinforcedPlasticWorkboat(Edition2003);31.RegulationforVentilationSystemsonBeardSeago-
ingShips(Edition2004);32. Regulation for The Corrosion Protection and Coating
Systems(Edition2004);33. Regulation for The Bridge Design on Seagoing Ships
OneManConsole(Edition2004);34. Guidelines for The Carriage of Refrigerated Contain-
ersonBoardShips(Edition2004);35.RegulationforAnalysisTechnique,StrengthandSta-
bility(Editionof2005);36. Guidelines for The Preparation of Damage Stability
Calculation and Damage Control Documentation OnBoard(Editionof2005);
37.Procedure & Guideline for ISPS Code (Edition of2004);
38.GuidelinesforThicknessMeasurementsofship’splate(Editionof2005);
39. Guidelines for Condition Assessment Scheme (CAS)(Editionof2006);
40. Guidelines for Classification & Construction of Wing-InGroundCraft(WIG-Craft)(Edition2006);
41.Guidance for ImplementationMarpol 73/78AnnexVI(Edition2006).
![Page 73: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/73.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
73 Annual Report 2011
Annual Report 2011 Laporan Tahunan
![Page 74: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/74.jpg)
Annual Report 2011 Laporan Tahunan
74PT Biro Klasifikasi Indonesia (Persero)
Pengembangan Sumber Daya ManusiaHuman Resources Development
BKI sebagai perusahaan yang bergerak di bidang jasa klasifikasi menempatkan sumber daya manusia yang handal dan berkompeten pada posisi terdepan dalam upaya menghadapi dan memenangkan persaingan bisnis dengan para perusahaan kompetitor serta dalam upaya meningkatkan kepercayaan stakeholder atau kualitas pe-layanan prima BKI. Prestasi kinerja usaha perusahaan yangtelahdicapaidalamtahun2011tidakterlepasdariprofesionalismedanpeningkatankompetensiSDMyangdihasilkan dari pola pembinaan dan pengembangan SDMyangdilakukansecaraterarahdanterpadu,sehing-gaprestasikinerjausahayangdicapaidalamtahun2011ditunjukkan dengan terjadinya peningkatan produktifi-tas, sehingga Man Power Productivity (MPP) meningkat sebesar 19% dibandingkan tahun sebelumnya menjadiRp552jutaperpersonil.SDMyangdimilikiBKIhinggaposisi31Desember2011berjumlah616orang.
Mengingat aset pokok yang dimiliki oleh BKI adalah sumber daya manusia, maka BKI menyadari sepenuhnya dan berkomitmen untuk senantiasa menjaga dan men-ingkatkankualitassertakompetensiSDMyangdimilikimelalui program diklat terpadu, dan khusus training bagi surveyor program diklat telah dibuat secara terpadu sesuai dengan ketentuan IACS-QSCS. Kompetensi yang dimilikiolehpersonilteknikBKIsampaidenganDesem-ber2011adalah:
BKI as a company which is engaged in the services classification puts human resources that are reliable and competent in the forefront of efforts to face the competition and win business with the company's competitors and stakeholders in an effort to boost confidence or BKI excellent service quality. Achieve-ments of the company's business performance has been achieved in 2011 can not be separated fromthe professionalism and competency improvement of human resources resulting from patterns of human resource training and development carried out as directed and integrated, so that the achievement of businessperformanceisachievedin2011isindicatedby the increase in productivity, so that Man Power Productivity(MPP)increasedby19%overtheprevi-ousyeartoIDR552millionperpersonnel.BKIhu-manrecourcesheld thepositionuntilDecember31,2011amountedto616people.
Given the main asset owned by BKI is human re-sources, BKI fully aware and committed to continu-ally maintaining and improving the quality and competence of human resources through integrated education and training program, and specialized training for surveyor and training program was cre-ated in an integrated manner in accordance with the provisions of IACS-QSCS. Competencies possessed by BKItechnicalpersonneluptoDecember2011were:
![Page 75: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/75.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
75 Annual Report 2011
RealisasiTurnOverSDMSesuaiPendidikanTahun2011 PosisiTenagaTekniktahun2011
Uraian JumlahBidang Klasifikasi1. PrincipalSurveyor(Class) 2. Senior Surveyor (Class) 3. Surveyor (Class) 4. Assistant Surveyor
Bidang Konsultansi & Supervisi1. RadiographyExpertLevelI 2. RadiographyExpertLevelII3. NDTLevelI4. NDTLevelII5. WeldingInspector6. WeldingInspector–AWS7. WeldingEngineering8. AK3Umum9. CraneInspector(Depnaker)10.CraneInspector(Migas)11.PipelineInspector12.Casing&TubingInspector13.TankStorageInspector14.RadiationProtectionOfficer15.OffshorePipelineInspector16.Cathodic/CorrosionInspector17.SeaSurvival18.PembinaanPemeriksaanTeknisdanPengujianKatupPengaman19.HUET20. Pressure Vessel Safety
Bidang Sertifikasi1. SafetyAuditor2. Quality Auditor3. ISPS Code
Sistem Informasi
Akuntan
19747137
38
2659182
422
796825244245
2438114858
7110280
63
37
![Page 76: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/76.jpg)
Annual Report 2011 Laporan Tahunan
76PT Biro Klasifikasi Indonesia (Persero)
Teknologi InformasiInformation Technology
Dalammeningkatkanpelayanan jasanya,BKI telahme-nyempurnakan sistem pelaporan survey secara on-line dari aplikasi sebelumnya yaitu aplikasi ‘Terpadu’ menjadi aplikasi “Classification and Statutory Reporting System” (CSRS). Penyempurnaan yang telah dilakukan antara lain lebih fleksibel sesuai kebutuhan surveyor, lampiran dari laporan survey sudah diintegrasikan, aplikasi lebih user friendly (WhatYou See IsWhatYouGet), updateform laporan survey lebih mudah dan seragam, update versi secara otomatis di masing-masing laptop surveyor dsb. Dengan aplikasi ini diharapkan terjadi percepatanpembuatan laporan survey termasuk pengiriman ke Kan-torPusatsecaraon-line.Dengandemikian,KantorPusatdapat segera memproses laporan survey tersebut tanpa harus menunggu hard copy dari surveyor lapangan.
In improving of services, BKI has modified a report-ing system in on-line basis from previous applica-tioncalled“TERPADU”'intonewapplicationcalled"Classification and Statutory Reporting System" (CSRs). Improvements that have been taken such as more flexible according to the needs of surveyors, the attachment of the survey report has been integrated, theapplicationmoreuserfriendly(WhatYouSeeIsWhatYouGet),easytoupdatethesurveyreportanduniformly, update version automatically to each sur-veyor’s laptop etc. With this application ,able to ac-celerate the process of preparing survey report includ-ingsubmittoHeadOfficeinon-linebasis.Thus,theHeadOfficecouldprocessthesurveyreportpromtlywithout waiting for a hard copy from the field sur-veyors.
CLASSIFICATION and STATUTORY REPORTING SYSTEM / CSRS
![Page 77: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/77.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
77 Annual Report 2011
Tanggung-jawab SosialSocial Responsibility
Perusahaan pada tahun 2011 telahmenyalurkan pinja-mandana sebesarRp 1.584 juta untukProgramKemi-traandanBinaLingkungan.Dana tersebut berasal daripenyisihan laba, sebagaimana telah disebutkan dalam keputusan RUPS dan dari pengembalian pinjaman.
Tujuan Program Kemitraan dan Bina Lingkungan adalah mengembangkan dan menciptakan iklim usaha yang se-hat dan menjaga tata hubungan yang mendorong tum-buhnya kondisi saling menunjang antara BUMN, kope-rasi dan swasta khususnya pengusaha kecil dan koperasi serta mendorong koperasi dan usaha kecil sebagai lem-baga ekonomi rakyat yang mampu melaksanakan, men-ingkatkan dan mengembangkan usahanya secara lebih efektif dan efisien serta dapat memberi nilai tambah dan manfaat yang lebih besar bagi para anggotanya maupun masyarakat di sekitar.
In2011,thecompanyhasgrantedfundloansamount-ingtoIDR1.584millionforthePartnershipandCom-munity Development Program. The funding comes from retain profit, as already mentioned in the decision of the RUPS and loan repayment.
The purpose of the Partnership and Community De-velopment Program is to develop and create a healthy business climate and keep shaping the conditions that encourage mutual support between the BUMN, coop-eratives and the private enterpreneurs ,especialy small entrepreneurs and to encourage cooperatives and small businesses as people's economic institutions capable of implementing, improving and develop their business more effectivelyand efficientlyand canprovideaddedvalue and greater benefits for its members and the com-munity around.
![Page 78: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/78.jpg)
Annual Report 2011 Laporan Tahunan
78PT Biro Klasifikasi Indonesia (Persero)
Adapun sasarannya adalah terciptanya kesempatan usaha dan lapangan kerja yang lebih luas bagi usaha kecil dan koperasi sampai ke masyarakat pedesaan, serta terseleng-garanya sistim manajemen yang lebih rasional dan efisien yang diikuti dengan peningkatan kemampuan baik per-modalan, personil, administrasi, keuangan maupun ke-mandirian wirausaha. Prioritas pembinaan tahun 2011kepada usaha kecil baik perorangan maupun badan dan Koperasi(KUD)terutamaKUDcalonmandiri.
Jumlahrealisasidanayangterdistribusipadatahun2011sebasarRp1.555jutayangdisalurkankepada5wilayahbinaan, yaitu :
The goal is the creation of business opportunities and greater job opportunities for small businesses and co-operatives to rural communities, as well as the imple-mentation of the management system more rational and efficient, followedbyan increase inboth theabilityofcapital, personnel, administrative, financial and entre-preneurialindependence.Developmentpriorityin2011to both individuals and small business entities and coop-eratives (KUD), especially KUD independent candidate.
Thedisbursed amount of funds distributed in 2011 isIDR1.555millionwhichisdistributedtothefivetargetareas, namely:
Wilayah Anggaran Realisasi
DKIJakartaDIYogyakarta
Jawa TimurJawa Barat
Jawa Tengah
Jumlah
400300300250250
1500
220255220160700
1555
![Page 79: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/79.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
79 Annual Report 2011
Annual Report 2011 Laporan Tahunan
![Page 80: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/80.jpg)
Annual Report 2011 Laporan Tahunan
80PT Biro Klasifikasi Indonesia (Persero)
Tata Kelola PerusahaanCorporate Governance
Penerapan Tata Kelola Perusahaan yang baik memberi-kan manfaat besar bagi kinerja Perusahaan secara kese-luruhan. Tata Kelola Perusahaan yang baik juga menjadi sarana perusahaan dalam mengembangkan asset dan akuntanbilitas kepada para stakeholder.
Rapat Umum Pemegang Saham (RUPS)
RUPS merupakan Organ Perusahaan yang memegang kekuasaan tertinggi dalam perusahaan dan memegang segalawewenangyangtidakdiserahkankepadaDireksiatauDewanKomisaris.RUPSberhakmemperolehselu-ruh informasi yang relevan tentang Perusahaan dan me-mintapertanggungjawabanKomisarisdanDireksiyangberkaitan dengan pengelolaan Perusahaan. Pada tahun 2011,PerusahaantelahmengadakanRUPSPengesahanRKAP2011padatanggal30Desember2010diJakarta,RUPS pertanggungjawaban Laporan Manajemen tahun 2010padatanggal10Juni2011diJakarta.
Dewan Komisaris
Dewan Komisaris bertugas mengawasi dan memberi-kanmasukan kepada Direksi demi kepentingan Peru-sahaan, Pemegang Saham serta pihak yang berkepent-ingan pada umumnya. Dewan Komisaris bertanggungjawabmemastikan agarDireksi dalam kondisi apapunmempunyaikemampuanmenjalankantugasnya.DewanKomisaris secara teratur memantau efektivitas pelaksan-aan kebijakan dan proses pengambilan keputusan yang dilakukanolehDireksiagarselalusesuaidengantujuan
Implementation of Good Corporate Governance gives great benefit to the overall Company performance. Good Corporate Governance is also a means for the company to develop assets, accountability to stakehold-ers and to maintain long-term value to stakeholders.
Shareholders’ Annual General Meeting (AGM)
AGM is a Company Organ which holds the highest au-thority in the company and holds all authorities that are not submitted to Board of Directors or Board of Commissioners. AGM reserves the right to obtain all relevant information concerning the Company and ask the accountability of Board of Commissioners and Board of Directors relating to Company management. In2011, theCompanyhasconductedAGMrelatedtoRKAP2011endorsementonDecember30,2010inJa-karta andAGMaboutManagementReport 2010 ac-countabilitydatedJune10,2011inJakarta.
Board of Commissioners
Board of Commissioners is responsible to oversee and advise the Board of Directors in the interest of the Com-pany, Shareholders and interested parties in general. Board of Commissioners is responsible to ensure that Board of Directors in any circumstances has the ability to carry out their duties. Board of Commissioners regu-larly monitor the effectiveness of policy implementation and decision-making process conducted by the Board of Directors to comply with company goals, and Share-
![Page 81: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/81.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
81 Annual Report 2011
perusahaan, arahan Pemegang Saham dan anggaran DasarPerusahaan.Dalammelaksanakantugasnya,De-wan Komisaris selalu mematuhi Anggaran Dasar danperaturanperundangan-undanganyangberlaku.DewanKomisaris sesuai dengan prosedur yang telah ditentukan dapat menggunakan saran profesional yang mandiri dan atau membentuk Komite-komite bila diperlukan. Susu-nanDewanKomisarisberdasarkanKeputusanMenteriBUMNNo. KEP-155/MBU/2009 tanggal 28 Juli 2009,adalah sebagai berikut :1. KomisarisUtama: Capt. Drs. Abdul Gani,
MM,MBA2. Komisaris: Drs.RiyadiWidiasmoro,MSi3. Komisaris: LiliekMayasari,SE4. Komisaris : Avian Muhtadi5. SekretarisDekom: Susi MeyristaTarigan, SE,
AK, MSAK
Pelaksanaan Tugas dan Tanggung Jawab Dewan Komisaris
PadaTahun2011,kegiatanDewanKomisarisPT.BiroKlasifikasi Indonesia (Persero) secara garis besar seba-gai berikut :1. DewanKomisaris telahmelakukanrapatsebanyak
18(Delapanbelas)kali,dimana8(Delapan)dianta-ranya dilakukandenganDireksi, 1(satu) bersama-samadenganDireksidanKAPKanakaPuradiredja,Suhartono,2(Dua)bersama-samadenganDireksidan SPA Consulting dan sisanya adalah rapat inter-nalDewanKomisaris.Rapatdilakukandalamrang-ka pembahasan kinerja perusahaan dan kegiatan korporasi serta terkait kegiatan pengawasan peru-sahaan. Hasil rapat dituangkan dalam risalah rapat dan didokumentasikan sesuai dinamika rapat.
2. Melakukan pengawasan terhadap kebijakan pengu-rusan, jalannyapengurusanolehDireksi termasukpengawasan terhadap pelaksanaan Rencana Kerja dan Anggaran Tahunan berdasarkan Anggaran Dasar,KeputusandanarahanRUPS,sertaperaturanperundang-undangan yang berlaku
3. Memberikan tanggapan, pendapat dan saran kepa-da Pemegang Saham atas kinerja perusahaan, kegia-tanpengawasanDewanKomisarisdanhal-hallainyang dimintakan pendapat oleh Pemegang Saham.
holders directions.In performing its duties, the Board of Commissioners have always adheres to the statutes and applicable reg-ulations. Board of Commissioners in accordance with the procedures can use an independent and professional advice or forming committees when needed.Board of Commissioners based on BUMN Ministerial DecreeNo.KEP-155/MBU/2009onJuly28,2009,areas follows:1. PresidentCommissioner :Capt.Drs.AbdulGani,
MM, MBA2. Commissioner : Drs. Riyadi Widiasmoro, MSi3. Commissioner:LiliekMayasari,SE4. Commissioner : Avian Muhtadi5. Commisioner Secretary : SusiMeyristaTarigan,
SE,AK,MSAK
Implementation of Duties and Responsibilities of Board of Commissioners
In2011,theactivitiesoftheBoardofCommissionersofPT. Biro Klasifikasi Indonesia (Persero) in outline as fol-lows:1. Board of Commissioners has conducted meetings 18
(eighteen) times,which the8 (eight)of themcarriedoutwiththeBoardofDirectors,1(one)withtheDirec-torsandKAPKanakaPuradiredja,Suhartono,2(two)with the Directors and the SPA Consulting and the rest are internal meetings of the Board of Commissioners. Meetings conducted in the framework of the discussion of corporate performance and corporate activities and related activities of the company's control. Results of the meeting stated in the minutes of meetings and docu-mented according to the dynamics of the meeting.
2. To supervise the administration policy, the course of administration by the Board of Directors include super-vising the implementation of Annual Work Plan and Budget (RKAT) according to Anggaran Dasar, deci-sions and direction of the RUPS, as well as laws and regulations applicable
3. Provide feedback, opinions and advice to shareholders on corporate performance, activities and supervision of the Board of Commissioners and other things that the opinion requested by the Shareholders.
![Page 82: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/82.jpg)
Annual Report 2011 Laporan Tahunan
82PT Biro Klasifikasi Indonesia (Persero)
4. Memberikan pendapat dan arahan atas Rencana JangkaPanjangPerusahaanTahun2011-2014sertarencanaperusahaanlainnyayangdisiapkanDireksi,seperti perubahan struktur organisasi, pengha-pusbukuanaktiva tetapperusahaan,proyekFLNGMasela, rencana pengembangan usaha di China dan kebijakan penanganan kegiatan klasifikasi di luar negerisertausulanRKAPtahun2012.
5. Memberikanpersetujuanmaupunrekomendasiatasperjalanan dinas Direksi ke luar negeri, realokasidana investasi, penghapusbukuan gedung Kantor Pusat 2 lantai, gedung Cabang Utama Tj. Priok serta kendaraan bermotor roda dua dan roda empat, per-setujuanDewankomisarisatasfasilitasgaransibank,sertacutitahunanDireksi
6. Mereview dan menindaklanjuti masukan serta reko-mendasi dari Komite Audit diantaranya mengenai pengadaanKAPuntukaudittahunbuku2011.Ber-sama dengan Komite Audit, melakukan review dan menerbitkan Piagam Komite Audit yang diperbaha-rui sesuai Prinsip-Prinsip GCG dan review proses lelang gedung kantor pusat
7. Menghadiri kegiatan korporasi seperti customer meeting,RakerdanTOMSItahun2011danmelaku-kan monitoring dengan kunjungan ke cabang/unit kerja yang perlu mendapat perhatian atas kinerja maupun program kerja strategisnya, sesuai program kerjaDewanKomisaristahun2011
8. Melaksanakan program pengembangan DewanKomisaris melalui keikutsertaan dalam workshop tentangmembangunKetahananHukumDalamMen-gantisipasi Kriminalisasi Pengambilan Kebijakan di BUMN yang diadakan oleh Pusat Studi Investasi dan KeuangansertaseminartentangPemahamanDasarLaporanKeuanganbagiDewanKomisarisBUMN.
Remunerasi Komisaris
Remunerasi adalah imbalan yang diberikan kepada Komisaris atas peran yang diberikan untuk penguru-san dan pengawasan Perusahaan adalah sesuai dengan Keputusan RUPS tanggal 25 Juni 2010 di Jakarta dankeputusanDireksiNo.DU.165/KP.310/KI-11tanggal10Agustus2011sebagaiberikut:
4.ProvideopinionandguidanceontheRencanaJangkaPanjang Perusahaan Tahun 2011 - 2014 and theother plan prepared by the Board of Directors , such as changes in organizational structure, corporate write-off of fixed assets, Masela FLNG project, abusiness development plan in China and the policy on the classification activities abroad as well as pro-posalsRKAP2012.
5.ApprovalandrecommendationtotheBoardofDirec-tors on business trips abroad, the reallocation of in-vestmentfunds,write-off2-storyHeadOfficebuild-ing, theTjPriokMainBranchOffice building , aswell as write-off motorcycles and cars, the approval of the bank guarantee facility, and annual leave of Directors
6. Review and follow up on input and recommenda-tions from the Audit Committee include the provi-sionofKAPtoauditthefinancialin2011.Togetherwith the Audit Committee, to review and publish an updated Charter of the Audit Committee in accord-ance Principles of GCG and the review process Head Officebuildingauction
7. Corporate activities such as attending customer meetings, Raker andTOMSI in 2011 and conductmonitoringvisitstothebranchofficethatneedat-tention on performance and strategic work program, accordingtotheworkprogramin2011oftheBoardof Commissioners
8. Implementing the BOC program developmentthrough participation in workshops on building Ketahanan Hukum Dalam Mengantisipasi Krimi-nalisasiPengambilanKebijakandiBUMNheldbyPusat Studi Investasi dan Keuangan as well as semi-nars on Pemahaman Dasar Laporan Keuangan for the Board of Commissioners of BUMN
Remuneration of Commissioners
Remuneration is the reward given to the Commissioners for the role given to the management and supervision of the Company are in accordance with the Keputusan RUPSonJune25,2010inJakartaandthedecisionoftheBoardofDirectorsNo.DU.165/KP.310/KI-11datedAugust10,2011asfollows:
![Page 83: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/83.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
83 Annual Report 2011
Efektifitas Kerja Komisaris
Komisarismengadakan rapat 1 (satu) bulan sekali dansewaktu-waktu apabila dianggap perlu untuk membic-arakan berbagai permasalahan dan bisnis Perusahan serta melakukan evaluasi terhadap kinerja Perusahaan. Panggilan rapat Komisaris dilakukan secara tertulis oleh Komisaris Utama atau anggota Komisaris yang ditunjuk olehKomisarisUtama.Dalampanggilanrapatdicantu-mkan acara, tanggal, waktu dan tempat.
Semua rapat Komisaris dipimpin oleh Komisaris Uta-ma.DalamhalKomisarisUtamatidakhadiratauberh-alangan, rapat Komisaris dipimpin oleh seorang anggota Komisaris lainnya yang ditunjuk oleh Komisaris Utama.
Semua keputusan dalam rapat Komisaris diambil dengan musyawarahuntukmufakat.DalamsetiaprapatKomisa-ris dibuat risalah rapat yang dapat menggambarkan situ-asi yang berkembang, proses pengambilan keputusan, argumentasi yang dikemukakan, kesimpulan yang di-ambil serta pernyataan keberatan terhadap kesimpulan rapat apabila tidak terjadi kebulatan pendapat.
Risalah rapat ditanda-tangani Pimpinan rapat Komisaris dan oleh salah seorang anggota Komisaris yang ditun-juk oleh dan dari antara mereka yang hadir. Setiap ang-gota Komisaris berhak menerima salinan risalah rapat Komisaris, meskipun yang bersangkutan tidak hadir dalam rapat tersebut.
Padatahun2011dewankomisaristelahmelakukanrapatinternalsebanyak13(Tigabelas)kali,denganprosentasekehadiran sbb :• Capt.AbdulGani(KomisarisUtama):100%• Drs.RiyadiWidiasmoro(Komisaris):100%• LiliekMayasari,SE,AK(Komisaris):100%
Commissioner Work Effectiveness
BoardofCommissionersmetevery1(one)monthandat any time if deemed necessary to discuss various is-sues and business enterprise and evaluation of company performance. Call meeting of Board of Commissioners is made in writing by President Commissioner or by a member of Board of Commissioners appointed by Presi-dent Commissioner. In a meeting call were included the agenda, date, time and place
All meetings chaired by the President Commissioner. In the case of President Commissioner is absent or una-vailable, the meeting is headed by a Commissioner ap-pointed by the President Commissioner.
All decisions taken at a meeting were taken with delib-eration and consensus. In each meeting the minutes of the meeting which can describe the situation envolving, the decision making process, the arguments presented, theconclusionsdrawnandthestatementofobjectionsto the conclusion of the meeting if there is not unanim-ity of opinion.
Minutes of the meeting signed by the Chairman of the meeting and one member of the Commissioners ap-pointedbyandfromamongthosepresent.Eachmem-ber of the Commissioner is entitled to receive a copy of the minutes of meetings although does not attend the meeting.
In2011theboardhasconducted13(thirteen)timesin-ternal meetings, with the percentage of attendance as follows:• Capt.AbdulGani(Commissioner):100%• Drs.RiyadiWidiasmoro(Commissioner):100%• LiliekMayasari,SE,AK(Commissioner):100%
Jabatan Nama Honorarium per bulanKomisaris UtamaKomisarisKomisarisSek.Dekom
Jumlah
Capt.Drs.AbdulGani,MM.MBADrs.RiyadiWidiasmoro,MSiLiliekMayasari,SESusiMeyristaTarigan,SEAk,MSAk
14.42012.980
12.9805.410
45.790
![Page 84: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/84.jpg)
Annual Report 2011 Laporan Tahunan
84PT Biro Klasifikasi Indonesia (Persero)
Dalam rapat internal tersebut, Dewan Komisaris jugamengundangDireksisebanyak8(delapan)kali.
Direksi
Direksidengan itikadbaikdanpenuh tanggung jawab,mengurus dan mengelola bisnis untuk kepentingan Pe-rushaan yang sebesar-besarnya. Dalam melaksanakantugasnya Direksi tetap memperhatikan keseimbangankepentingan seluruh pihak yang terkait dengan aktivi-tas Perusahaan. Direksi bertindak secara cermat, ber-hati-hati dan mempertimbangkan berbagai aspek pent-ing yang relevan dalam pelaksanaan tugasnya. Direksimenggunakan wewenang dan sumber daya yang dimi-liki Perusahaan semata-mata hanya untuk kepentingan Perusahaan.
Direksimempunyaitugasutama:• Memimpindanmengurusperusahaansesuaidengan
maksud dan tujuan perusahaan.• Meningkatkanefisiensidanefektifitasperusahaan.• Menerapkanpraktik-praktik tata kelolaperusahaan
yang sehat dalam perusahaan.• Bertugas sesuaiAnggaranDasarPerusahaan,kepu-
tusan RUPS serta peraturan lainnya.• Direksibertanggungjawabkepadapemegangsaham
melalui Rapat Umum Pemegang Saham.
SusunanDireksiberdasarkanKeputusanMenteriBUMNNo.KEP-259/MBU/2010 tertanggal 06Desember 2010sebagai berikut :1. DirekturUtama:Capt.Purnama,MM2. DirekturKeu.&Personalia:EdyCahyono,ST,MSM3. DirekturTeknik&Pengembangan:Ir.Ajatiman4. DirekturOperasi&Pemasaran:Ir. Setudju
Dangkeng,SE
Remunerasi Direksi
RemunerasiadalahimbalanyangdiberikankepadaDi-reksi atas peran yang diberikan untuk pengurusan dan pengelolaan Perusahaan adalah sesuai dengan Keputu-sanRUPStanggal25 Juni2010di JakartadanKeputu-sanDireksiDU.165/KP.310/KI-11tanggal10Agusutus2011,sebagaiberikut:
In internal meetings, the Board of Directors are also in-vitedasmanyas8(eight)times.
Directors
Directors in good faith and responsibly, taking care of and manage the business for Company interest as big as possible. In performing their duties, the board due regard to balance the interests of all parties related to Company activities. Board of Directors acted very care-fully, be cautious and consider about various important aspects which are relevant in performing their duties. Directors use the authority and resources owned by the Company solely for Company interest.
Directors have the primary duties: • Leadandmanagethecompanyinaccordancewith
itsaimsandobjectives.• Improveefficiencyandeffectivenessofthecompany.• Apply the practices of good corporate governance
within the company. • AssignedbasedonCompany'sstatutes,thedecision
of AGM and other rules.
Board of Directors based on Minister BUMN Decree No.KEP-259/MBU/2010 - December 6, 2010 as fol-lows:1. PresidentDirector: Capt.Purnama,MM2. DirectorofMonetary&Personnel:EdyCahyono,
ST, MSM3. DirectorofTechnical&Development:Ir.Ajatiman4. DirectorofOperations&Marketing : Ir.Setudju
Dangkeng,SE
Remuneration of Directors
Remuneration is the reward which is given to the Di-rectors for the role that given to the maintenance and management of the Company are in accordance with theDecisionoftheRUPSdatedJune25,2010inJakar-taandtheDecisionoftheDirectorsdated10Agusutus2011NoDU.165/KP.310/KI-11DU,asfollows:
![Page 85: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/85.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
85 Annual Report 2011
SelainRemunerasidiataskepadaDireksijugadiberikanfasilitas kendaraan dinas operasionalmasing-masing 1(satu) unit sesuai dengan azas kepantasan dan kemam-puan perusahaan.
Efektifitas Kerja Direksi
SecaraumumefektifitasdankinerjaDireksiditentukanberdasarkan tugas kewajiban yang tercantum dalam peraturan perundang-undangan yang berlaku dan Ang-garanDasarPerusahaanmaupunamanatPemegangSa-ham.Direksimengadakanrapat1(satu)bulansekalidansewaktu-waktu apabila dianggap perlu oleh seorang atau lebihanggotaDireksi.Panggilan rapat Direksi dilakukan secara tertulis olehanggota Direksi yang berhak mewakili Perusahaan.Dalam panggilan rapat tersebut dicantumkan acara,tanggal, waktu dan tempat rapat. Panggilan rapat terlebih dahulu tersebut tidak disyaratkan apabila semua anggota Direksihadirdalamrapat.
Pada tahun2011,Direksimelakukan rapat internal se-banyak 18 (Delapan belas) kali dan melakukan rapatkoordinasi dengan Dewan Komisaris sebanyak 8 (De-lapan) kali, dengan prosentase kehadiran sebagai berikut:• Capt.Purnama,MM :100%• EdyCahyonoST,MSM:100%• Ir.Ajatiman :100%• Ir.SetudjuDangkeng :100%
Hubungan Kerja antara Dewan Komisaris dan Direksi
Dalamhaldianggapperlu,Komisarisdapatberinisiatifmenyelenggarakan Rapat Konsultatif dengan Direksiuntuk membicarakan masalah perusahaan yang relevan.
In addition to the above remuneration to the Directors were also given the facility operational service vehicles each1(one)unit inaccordancewith theprinciplesofmerit and ability of the company.
Job effectiveness of the Board of Directors
In general, the effectiveness and performance of the Board of Directors determined based on the duties listed in the legislation in force, and Articles of Asso-ciation and Shareholders' mandate. BoardofDirectorsmeeting1(one)monthandatanytime if deemed necessary by one or more members of the Board of Directors.Call a meeting of Directors is made in writing by a member of Board of Directors entitled to represent the Company. In the meeting call were included the agenda, date, time and place of the meeting.
In2011,theBoardofDirectorsconductinternalmeet-ingsasmanyas18(eighteen)timesandconductcoor-dination meetings with the Board of Commissioners as manyas8(eight)times,withthepercentageofattend-ance as follows:• Capt.Purnama,MM:100%• EdyCahyonoST,MSM:100%• Ir.Ajatiman:100%• Ir.SetudjuDangkeng:100%
Working relationship between Board of Commis-sioners and Directors
In case considered necessary, Board of Commissioners may initiate Coordination Meeting with Board of Di-rectors to discuss relevant company’s issues. Similarly,
Jabatan Nama Honorarium per bulan
Tunjangan perumahan
Total Per Bulan
Dir.UtamaDir.Keu&PersonaliaDir.Teknik&PengembanganDir.Operasi&Pemasaran
Jumlah
Capt. Purnama,MMEdyCahyonoST,MSMIr. AjatimanIr. Setudju
36.05032.44532.44532.445
133.385
10.8159.7359.7359.735
40.020
46.86542.18042.18042.180
173.405
![Page 86: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/86.jpg)
Annual Report 2011 Laporan Tahunan
86PT Biro Klasifikasi Indonesia (Persero)
Demikian pula bila dianggap perlu,Direksi dapat ber-inisiatif menyelenggarakan Rapat Koordinasi dengan Komisaris untuk membicarakan masalah perusahaan yang relevan. Dalam setiap pertemuan, informasi dandatayangpentinguntukpemahamanDewanKomisarisakan diberikan secara tertulis sebelum pertemuan un-tukmenjamin tersedianyawaktu bagiDewanKomisa-ris untuk memahami permasalahan yang akan dibahas. Bila perluDireksi membuat ringkasan bahan tersebutsepanjang tidak mengurangi esensi informasi yang dapat mempengaruhi pengambilan keputusan.
Dalam setiap Rapat Konsultatif tersebut dibuat risalahrapat yang dapat menggambarkan situasi yang berkem-bang, proses pengambilan keputusan argumentasi yang dikemukakan, kesimpulan yang diambil, serta pernyat-aan keberatan terhadap kesimpulan rapat apabila tidak terjadikebulatanpendapat.Selamatahun2011,DireksidanDewanKomisaris telahmelakukanRapatKonsult-antif sebanyak 7 (tujuh) kali.
Komite Audit
Tugas dan tanggung jawab Komite Audit sebagaimana tercantum dalam Piagam Komite Audit yang ditetapkan denganSKKomisarisUtamaNo.KU.002/Dekom.101/X/KI-09 tanggal 22 Oktober 2009 menyebutkan, Komite Audit sebagai organ Komisaris bertugas memberikan masukan kepada Dewan Komisaris terhadap laporanatauhal-halyangdisampaikanolehDireksikepadaDe-wan Komisaris, mengindentifikasi hal-hal yang memer-lukan perhatian Dewan Komisaris, dan melaksanakantugas-tugas lain yang berkaitan dengan tugas DewanKomisaris.
Susunan Komite Audit :Ketua :Drs.RiyadiWidiasmoro,MSiAnggota:-TriAshadiSE,MM -Suwarno,SE
KomiteAuditdalamtahun2011telahmelaksanakantu-gas sbb:1. Memonitor Perkembangan proses Audit KAP atas
auditlaporankeuangantahun2010sertamenginfor-masikannyakepadaDewanKomisaris
if deemed necessary, Directors may initiate Coordina-tion Meeting with Board of Commissioners to discuss relevant company’s issues. In each meeting, informa-tion and data important for the understanding of Board of Commissioners will be given in writing before the meeting to ensure time availability for the Board to understand issues discussed. If necessary, Board of Directors can make a summary of material provided as long as they do not reduce the essential information that can influence in decision making.
In each consultative meeting will be made the minutes of meeting which can describe the situation evolving, decision-making process, arguments presented, con-clusionsdrawn,andstatementofobjectionstomeet-ing conclusion when there is no opinion unanimity. During year 2011, Board of Directors and Board ofCommissioners have held coordination meetings as many as 7 (seven) times.
Audit Committee
Duties and responsibilities of Audit Committee as con-tained in Charter of the Audit Committee established bySKCommissionerno.KU.002/Dekom.101/X/KI-09dated October 22, 2009 mentioning, Audit Committee as an organ of Board of Commissioners is charged in providing recommendations to Board of Commission-ers on the report or other matters submitted by Board of Directors to Board of Commissioners, in identifying the things require the attention of Board of Commis-sioners and perform other tasks related to the duties of Board of Commissioners.
The composition of the Audit Committee:Chairman : Drs. Riyadi Widiasmoro, MSiMembers:-TriAshadiSE,MM -Suwarno,SE
AuditCommitteein2011hadbeenfulfilloutthefol-lowing tasks:1.MonitorthedevelopmentoftheAuditKAPforthe
2010forfinancialstatementauditandinformtheBOC.
![Page 87: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/87.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
87 Annual Report 2011
2. Memberi pendapat dan masukan kepada DewanKomisaris atas laporan manajemen tahun 2010,LaporanManajemenTriwulanI/2011danLaporanManajemenTriwulanII/2011danLaporanManaje-menTriwulanIII/2011
3. Memberi pendapat dan masukan kepada DewanKomisarisatasRevisiDraftRKAP2012
4. Memberi pendapat dan masukan kepada DewanKomisaris atas Draft Struktur Organisasi PT. BKI(Persero)
5. Mereview Piagam Komite Audit danmengusulkanperubahannyakepadaDewanKomisaris
6. Mengikuti rapat internal Dekom membahas DraftStruktur Organisasi PT. BKI
7. Memberi pendapat dan masukan kepada DewanKomisarisataslaporankeuanganaudited2011
8. MeetingdenganDewanKomisaris,DireksidanKAPmembahas proses dan hasil audit KAP atas laporan keuangan2010
9. Memberi pendapat dan masukan kepada DewanKomisarisatasDraftRJPP2011-2014
10.Melakukan pembahasan dengan KAP, Ka SPI danKadiv Keuangan berkenaan dengan tindak lanjut perbaikanisiLaporanKeuangan2010Auditedsesuaidengan hasil rapat Dewan Komisaris, Direksi danKAP
11.Memberikankomentarterhadapbeberapadokumen:AgreementABS,MOUJME,PerjanjianKopESDM
12.Menghadiri cek posisi di Kantor Pusat dan RakerBKIdiYogyakarta
13.Memonitor beberapa cabang BKI bersama denganDewanKomisaris
14.Memberi pendapat dan masukan kepada DewanKomisaris atas proses lelang gedung kantor pusat
15.Memberikan pendapat dan masukan atas usulanRKAPtahun2012
16.Memberikan pendapat atas usulan realokasi danainvestasi kendaraan bermotor menjadi pembelian tanah di Cigading
Sistem Pengendalian Internal
Perusahaan telah memelihara sistem pengendalian inter-nal keuangan yang menjamin keandalan sistem akuntan-si. Sistem pengendalian internal keuangan diberlakukan untuk memberikan jaminan yang wajar dalam hubun-
2.GiveopinionsandadvicetotheBOCforthe2010managementreport,1st-2011QuarterlyManage-ment Report and 2nd -2011 QuarterlyManage-mentReportand3rd-2011ManagementReport.
3. Give opinions and advice to the BOC on Revision DraftRKAP2012.
4. Give opinions and advice to the BOC on Draft Or-ganization Structure PT. BKI (Persero)
5. Reviewing the Audit Committee Charter and theproposed amendments to the BOC.
6. Held the internal meeting to discuss Draft Organi-zation Structure PT. BKI
7. Give opinions and advice to the BOC on audited financialstatements2011
8.MeetingwithBOC,Directors andKAP todiscussthe process and results of KAP audit the financial statements2010
9.GiveopinionsandadvicetotheBOCfor2011-2014DraftRJPP
10.ConductdiscussionswithKAP,KaSPIandKadivKeuangan regarding the content of the follow-up repair 2010 Audited Financial Statements in ac-cordance with the BOC, BOD and KAP meeting.
11.Commenton some documents:ABSAgreement,MOUJME,KopEMRAgreement
12.AttendingthecheckpositionsatHeadOfficeandRakerBKIinYogyakarta.
13. Monitoring several branches together with theBOC.
14.GiveopinionsandadvicetotheBOCfortheauc-tionprocessofHeadOfficebuilding
15. Provide opinions and input on the proposal of2012RKAP
16.Provideanopinionontheproposedreallocationofvehicles investment funds in to purchase land in Cigading
Internal Control System
The company has been maintaining internal control system which ensures the reliability of financial ac-counting systems. Financial internal control system put in place to provide reasonable assurance in rela-
![Page 88: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/88.jpg)
Annual Report 2011 Laporan Tahunan
88PT Biro Klasifikasi Indonesia (Persero)
gannya dengan menjaga asset dari penyalah gunaan dan peralihan kepemilikan secara tidak sah, menjaga keabsa-han catatan-catatan akuntansi dan keandalan informasi keuangan yang dapat dipercaya yang digunakan dalam Perusahaan maupun yang dipublikasikan.
Pelaksanaan tugas pengendalian internal merupakan tanggung jawab seluruh unit/satuan kerja. Perusahaan menetapkan Satuan Pengawasan Intern (SPI) seba-gai unit yang bertanggung jawab atas efektivitas sis-tem pengendalian internal. Selain itu perusahaan juga membentuk Satuan Jaminan Mutu (Satjamtu) sebagai penanggung jawab diterapkan Sistem Manajemen Mutu berdasarkan persyaratan standar ISO 9001:2008 seba-gai wujud komitmen manajemen dalam meningkatkan kepuasan pemakai jasa (Customer statisfaction) dan penyempurnaan yang berkesinambungan (Continuous Improvement).Dalammendukungaktivitaspengenda-lian internal, Perusahaan senantiasa menjamin indepen-densi SPI dan Satjamtu dalam melaksanakan audit serta meningkatkan kompetensi para auditornya. SPI selama tahun2011telahmelakukanauditoperasionalterhadap14 (Empat belas) unit kerja, sedangkan Satjamtu telahmelakukanaudit terhadap14 (Empatbelas)unitkerja,meliputi Kantor Pusat dan Unit Produksi.
Auditor Eksternal
Sesuai keputusan RUPS tanggal 25 Juni 2010 RUPSmemberikan kuasa kepada Dewan Komisaris untukmenunjuk KAP yang akan bertindak sebagai Auditor Independen untuk melaksanakan audit atas Laporan Tahunan dan Perhitungan Tahunan PT. Biro Klasifikasi Indonesia(Persero)TahunBuku2010.Selanjutnya,ber-dasarkan proses pengadaan sesuai dengan ketentuan yangberlakudanprinsipGCG,DewanKomisaristelahmenunjuk KAP KANAKA PURADIREDJA, SUHAR-TONO sebagai Auditor atas Laporan Keuangan PT. BKI tahunbuku2011.
AuditoreksternaltersebutterbebasdaripengaruhDewanKomisaris,Direksidanpihak-pihakyangberkepentingandalam Perusahaan, serta perusahaan wajib menyediakan semua catatan akuntansi dan data penunjang yang diper-lukan auditor eksternal sehingga memungkinkan auditor eksternal memberikan pendapatnya tentang kewajaran,
tion to the keeping of assets from misuse and unau-thorized transfer of ownership, maintaining the valid-ity of accounting records and the reliability of reliable financial information used by the Company those were published.
The implementation of tasks of internal control is the responsibility of all working units. The Company pro-vided an Internal Audit Unit (IAU) as the unit respon-sible for the effectiveness of internal control system. The company also established the Quality Assurance Unit as the one which is responsible for the imple-mentation of Quality Management System based on ISOstandardrequirements9001:2000asapartofitscommitment to improve management of customer sat-isfaction and continuous improvement. In supporting internal control activities, the company has ensured the independence of ISU and Quality Assurance Unit in conducting audits and increased auditors’ compe-tence.SPIduringyear2010hasconductedoperationalaudits of 14 (fourteen) business units,whileQualityAssuranceUnithasconductedauditsof14(fourteen)businessunits,includingHeadOfficeandProductionUnits.
External Auditor
InaccordancewiththeAGMdecisiondatedJune25,2010,AGMgivesauthorizationtoBoardofCommis-sioners to appoint the accounting firm that will act as an independent auditor to conduct an audit of annual reports and yearly calculation. BKI year 2010. Fur-thermore, based on audit result of the financial state-ments in fiscal year 2009 and as proposed by Board of Directors, Board of Commissioners approved re-appointment ofKanaka Puradiredja, SuhartonoAc-countantOfficeasauditorofBKIfinancialstatementyear2011.
The external auditor is free from the influence of Board of Commissioners and Directors and interested par-ties within the Company, and company must record all necessary supporting data needed by external audi-tors so that enable the external auditor to provide his opinion about the fairness, reliability, and consistency
![Page 89: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/89.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
89 Annual Report 2011
ketaat azasan dan kesesuaian laporan keuangan Perusa-haan dengan Standar Akuntansi Keuangan Indonesia.Tugas Auditor Eksternal adalah melakukan audit ataslaporan keuangan Perusahaan dan memberikan penda-pat (opini) secara independen terhadap kewajaran dan kesesuaian laporan keuangan Perusahaan dengan Stand-ard Akuntansi Keuangan dan peraturan perundang-undangan yang berlaku. Perusahaan menjamin proses penunjukanAuditorEksternaldanpelaksanaanauditdi-lakukansecaraindependentanpapengaruhDireksidanpihak-pihak diluar Perusahaan. Besarnya jasa audit yang dibayarkan Perusahaan untuk laporan keuangan tahun 2011yaituRp.102.850.000,-termasukPPN10%.KantorAkuntan Publik KANAKA PURADIREDJA, SUHAR-TONO tidak memberikan jasa konsultasi lainnya kepada perusahaan.
Integritas dalam berusaha
Penerapan standar etika dalam seluruh kegiatan usaha berdasarkan prinsip-prinsip GCG melandasi seluruh aktivitas Perusahaan dalam menjalankan usahanya. Se-luruh jajaran Perusahaan telah mensosialiasikan GCG Code ini untuk mempertahankan kejujuran, transparan-si, independensi, akuntanbilitas, integritas, dan keadilan dalam proses kerja dan transaksi di lingkungan masing-masing.
Perusahaan telah menerapkan fungsi pengawasan den-gan menggunakan audit berdasarkan prinsip-prinsip yang benar dan berlaku umum serta senantiasa men-gupayakan agar tindakan-tindakan ilegal, tidak fair dan pelanggaran atas norma-norma dan peraturan yang ber-laku dapat dikenai sanksi, baik administrasi, maupun perdata. Menjadi kewajiban setiap unit kerja untuk sen-antiasa menindaklanjuti setiap temuan hasil audit yang disampaikan oleh fungsi pengawasan. Perusahaan telah menetapkankebijakanmelaranganggotaKomisaris,Di-reksi dan seluruh karyawan Perusahaan dan pihak yang terkait melakukan transaksi yang bertentangan dengan hukum dan prinsip-prinsip GCG. Apabila transaksi tersebut terbukti terjadi, maka setiap pihak yang terlibat langsung akan dikenai sanksi administratif dan tuntu-tan sesuai hukum yang berlaku. Pengertian yang ber-tentangan dengan hukum dan prinsip-prinsip GCG di-gunakan untuk menggambarkan setiap transaksi bisnis
of Company’s financial statement with Indonesian Financial Accounting Standard. The task of external auditor is to conduct an audit of company's financial statements and give an opinion independently about fairness and consistency of Company’s financial state-ment with Financial Accounting Standards and ap-plicable regulations. The Company guarantees the process of appointing external auditors and audit im-plementation was conducted independently without any influence of Board of Directors and parties outside the company. The amount of auditing services paid by the company for financial reporting year 2010 isRp102.850.000,-includingVAT10%.KanakaPura-diredja, SuhartonoAccountingFirmdidnotprovideother consulting services to the company.
Integrity in business
Ethical standards in all business activities based onGCG principles underlie all activities of the company to run its business. All levels of the company have so-cialized this Code GCG to maintain honesty, trans-parency, impartiality, accountability, integrity and fairness in work processes and transactions in their respective environment.
The Company has implemented a monitoring func-tion by using audits based on correct principles and generally accepted and always strive to be illegal, un-fair and a violation of the norms and regulations can besubjecttosanctions,bothadministrativeandcivilliability. It has been the responsibility for each busi-ness unit to constantly follow up on any audit findings submitted by the supervisory function. The Company has established a policy to prohibit Board of Commis-sioners, Directors and all employees and related par-ties engaged in transactions that violate the law and principles. When these transactions are proven to oc-cur, then each party which is directly involved will be given administrative sanction and demand in accord-ance with applicable law. Understanding that violate the law and principles of GCG is used to describe any business transaction categorized unlawful or contrary to the integrity of the company. Such transactions are,
![Page 90: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/90.jpg)
Annual Report 2011 Laporan Tahunan
90PT Biro Klasifikasi Indonesia (Persero)
yang dikatagorikan melawan hukum atau bertentangan dengan integritas Perusahaan. Transaksi tersebut, antara lain pemberian atau penerimaan suap dan hadiah yang diberikan dalam upaya mempengaruhi keputusan yang berkaitan dengan bisnis Perusahaan.
Hubungan dengan Pemegang Saham
Perusahaan telah melakukan hubungan dengan Pemeg-ang Saham sesuai dengan peraturan perundang-undan-gan yang berlaku. Perusahaan berusaha keras agar mem-berikan kontribusi yang optimal dan berkesinambungan bagi Pemegang Saham. Perusahaan selalu berusaha agar terjadi pertumbuhan yang berkesinambungan.
Keselamatan dan Kesehatan Kerja serta Pelestarian Lingkungan
Perusahaan selalu mengutamakan keselamatan dan kes-ehatan kerja serta pelestariaan lingkungan. Perusahaan menyadari bahwa pengelolaan kesehatan dan keselama-tan kerja yang prima dan tanggung jawab terhadap ling-kungan sangat penting bagi keberhasilan perusahaan jangka panjang.
Perusahaan telah mengambil tindakan yang tepat untuk menghindari terjadinya kecelakaan dan gangguan kes-ehatan di tempat kerja. Perusahaan telah mengusahakan agar pegawai memperoleh tempat kerja yang aman dan sehat. Untuk maksud tersebut Perusahaan telah memas-tikan bahwa asset-asset dan lokasi usaha serta fasilitas lainnya, memenuhi peraturan perundang-undangan yang berlaku berkenaan dengan persyaratan kesehatan dan keselamatan kerja serta pelestariaan lingkungan.
Perusahaan juga memilki kewajiban untuk senantiasa melengkapi dan menyediakan alat, sarana dan perleng-kapan keselamatan dan kesehatan kerja agar seluruh surveyor dan inspektor dapat bekerja aman dan selamat. Dalam prakteknya, Perusahaan memilki HSE (Health,Safety & Environment) Manual sebagai acuan dalampelaksanaan dan pengendalian aspek Kesehatan, Kes-elamatan dan Perlindungan Lingkungan Kerja.
among others, giving or receiving bribes and gifts in an effort to influence decisions related to corporate busi-ness.
Relation with Shareholders
Company has made relation with the Shareholders in accordance with laws and regulations. Company always tries hard to give an optimal and sustainable contribution to the Shareholders. Company always tries to make sustainable growth.
Safety and Occupational Health and Environ-mental Conservation
Company always gives priority to safety, health and environmental conservation. The Company recogniz-es that the management of good occupational health and environmental responsibility is very important for long-term corporate success.
The Company has taken appropriate action to avoid accidents and health problems in the workplace. Com-pany always makes sure that employees work in a safe and healthy workplace. For this purpose the Company has ensured that the asset, work location and other fa-cilities, meet the applicable statutory regulations with respect to health and safety requirements and environ-mental conservation.
The Company also has an obligation to always com-plete and provide tools, facilities and safety and health equipment in order that all surveyors and inspectors can work securely and safely. In practice, the Company hasHSE(Health,Safety&Environment)Manualasareference in the implementation and control of Health, SafetyandEnvironmentalProtectionWorkaspects.
![Page 91: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/91.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
91 Annual Report 2011
Pengadaan dan Hubungan dengan Rekanan
Perusahaan telah menerapkan proses pengadaan sesuai prinsip GCG, antara lain menjunjung prinsip-prinsip keterbukaan, kompetitif, fair dan dapat dipertanggung jawabkan (accountable). Proses pengadaan tidak ber-tentangan dengan peraturan perundang-undangan yang berlaku.
Untuk pengadaan barang dan jasa, Perusahaan memi-liki peraturan yang jelas dan tertulis untuk menjamin bahwa pelaksanaan pengadaan barang dan jasa berja-lan sesuai dengan prinsip-prinsip tersebut diatas. Proses yang demikian akan memberikan manfaat yang sebesar-besarnya untuk kepentingan Perusahaan dan memberi-kan kesempatan yang sama kepada semua rekanan un-tuk berkompetisi dalam proses pengadaan sesuai dengan kemampuandanpengalamanmereka.Dalampemilihanrekanan untuk proses pengadaan tidak diperbolehkan menunjuk rekanan yang dapat menimbulkan benturan kepentingan dengan Komisaris, Direksi, pejabat atau-pun personil di BKI. Selain itu dalam pemilihan barang atau rekanan, diupayakan semaksimal mungkin untuk mempergunakan produk Dalam Negeri dengan tetapmempertimbangan aspek kualitas, efisien dan efektivitas serta tidak bertentangan dengan peraturan perundang-undangan.
Kemitraan dengan Masyarakat Sekitar
Perusahaan tanggap dan memperhatikan masalah-masalah masyarakat, khususnya yang tinggal dalam wilayah operasi Perusahaan. Perusahaan telah men-egakkan komitmen bahwa dimanapun Perusahaan beroperasi hubungan baik dengan masyarakat sekitar merupakan landasan pokok bagi keberhasilan jangka panjang Perusahanan. Menyadari bahwa masing-masing masyarakat sekitar mempunyai karakterisktik yang ber-beda, sudah seharusnya Perusahaan berusaha mema-hami dan berinteraksi dengan masyarakat sekitar dan membantu masyarakat dengan cara yang wajar dengan memperhatikan kemampuan Perusahaan serta keten-tuan yang berlaku. Perusahaan sangat menghargai setiap aktivitas kemitraan yang memberikan kontribusi kepada masyarakat dan meningkatkan nilai sosial Perusahaan.
The process of Procurement and Relationship with Part-ners
The Company has implemented a procurement process in accordance with GCG, among others, upholding the principles of openness, competitive, fair and account-able. The procurement process does not conflict with applicable legislation.
For goods and service procurement, the Company has clear, written rules to ensure that the implemen-tation of the goods and service procurement in line with principles mentioned above. Such processes will provide maximum benefit for company interest and provide equal opportunity to all partners to compete in procurement process in accordance with their capa-bilities and their experience. In choosing a partner for the procurement process, it was not allowed to appoint a partner that could cause conflict of interest with BoardofCommissioners,Directors,officersorperson-nel in BKI. Also in the selection of goods or partner, sought as maximally as possible to use the product in the country by staying consider aspects of quality, eco-nomical and financial aspects so that do not conflict with legislation.
Partnership with the Neighborhood Community
Company is responsive and paying attention to com-munity issues, especially those who live in operation area. The Company has established a commitment that wherever the Company operates a good relation-ship with surrounding communities is a basic founda-tion for long term success of the Company. Realizing that each community has different characteristic, the company should try to understand and interact with surrounding communities and help people with a rea-sonable way by taking into account the ability of the Company and applicable regulations. Company ap-
![Page 92: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/92.jpg)
Annual Report 2011 Laporan Tahunan
92PT Biro Klasifikasi Indonesia (Persero)
Kemitraan dengan masyarakat sekitar telah dilaksanakan oleh Unit Program Kemiteraan dan Bina Lingkungan.
Penerapan Teknologi
Perusahaan selalu berupaya, mengadopsi teknologi dan standar yang diakui dalam mengembangkan dan mem-publikasikan Rules & Regulation BKI sebagai acuan bagi BKI melakukan pelayanan jasa survey dan sertifikasi. Penerapan Teknologi Informasi juga telah dikembang-kan dalam rangka peningkatan pelayanan jasa dan per-cepatan proses produksi serta pelaporan keuangan dan sistem pelaporan lainnya.
Manajemen Risiko
Perusahaan menyadari sepenuhnya bahwa operasi Pe-rusahaan tidak terbebas dari berbagai risiko, baik risiko yang berada di bawah kendali Perusahaan maupun risiko yang berada diluar kendali Perusahaan. Perusahaan telah mengendalikan dan meminimalkan risiko-risiko yang bersifat internal dengan menerapkan prinsip kehati-hatian (prudential management) dan prinsip-prinsip manajemen risiko. Sedangkan risiko-risiko yang ber-sifat ekternal, Perusahaan berusaha mengidentifikasi secara seksama dan mengevaluasi peluang terjadinya dan dampaknya terhadap Perusahaan. Perusahaan mel-akukan identifikasi terhadap kemungkinan munculnya risiko-risiko baik eksternal maupun internal tersebut. Atas dasar identifikasi itu, Perusahaan melakukan upaya-upaya yang diperlukan untuk meminimalkan terjadinya risiko tersebut, dengan merancang kontrak sedemikian rupa sehingga secara legal Perusahaan terlindungi dari risiko yang tidak perlu atau dengan melakukan teknik analisis keuangan tertentu sedemikian rupa sehingga resiko yang mungkin timbul tidak mengurangi nilai pe-rusahaan secara drastis. Namun demikian, perusahaan juga menyadari adanya risiko yang berada di luar kendali yang tidak dapat diminimalkan dampaknya oleh upaya-upaya internal.
Hubungan dengan Pejabat Negara
Adalah kebijakan Perusahaan untuk mengembangkan dan memelihara hubungan baik dan komunikasi efek-tif dengan setiap jajaran Pejabat Negara yang memiliki
preciates any partnership activities that contribute to the community and enhance Company’s social value.
Technology Application
The Company always strives to adopt technology and standards that are recognized in developing and pub-lish BKI Rules & Regulations as a reference for BKI to conduct survey and certification services. The ap-plication of information technology has also been de-veloped in order to improve service and production process acceleration and financial reporting and other reporting system.
Risk Management
Company is fully aware that the company is not free from risk, whether risk is under control and the risks that are beyond the company’s control. The Company has controlled and minimized the risk of internal ac-tivities by applying prudential management and risk management principles. Whereas external risks, the Company is carefully trying to identify and evalu-ate opportunities and their impact for the Company. Based on the basis of this identification, the Company made necessary efforts to minimize such risks, by de-signing contracts so that company is legally protected from unnecessary risks or to perform certain financial analysis techniques in such a way that risks that may arise does not reduce Company’s value drastically. However, the Company is also aware of risks beyond the control of which can not be minimized its impact by the effort internally.
Relationship with State Officials
It is company policy to develop and maintain good re-lationships and effective communication with all lev-elsofstateofficialswhohaveauthorityinthefieldof
![Page 93: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/93.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
93 Annual Report 2011
wewenang pada bidang operasi Perusahaan dalam batas toleransi yang diperbolehkan oleh hukum.
Data Perusahaan dan Kerahasiaan Informasi
Catatan yang akurat dan terandalkan mengenai ak-tivitas usaha dan operasional Perusahaan telah dipeli-hara setiap waktu. Setiap pembayaran uang, pengali-han kepemilikan, penyelesaian pemberian layanan, dan transaksi lainnya harus terefleksikan secara penuh dan detail pada sistem akuntansi dan catatan bisnis Peru-sahaan. Semua pihak harus mengungkapkan semua informasi yang relevan dan bekerja sama sepenuhnya dengan auditor internal dan eksternal dalam proses audit kepatuhan atau penyidikan lainnya.
KebijakanPerusahaantelahmelarangKomisaris,Direksidan karyawan untuk mengungkapkan informasi yang bersifat rahasia mengenai Perusahaan atau pelanggan kepada pihak ketiga, baik didalam maupun diluar Peru-sahaan. Mengingat bahwa pengungkapan informasi rahasia tersebut dapat merugikan Perusahaan atau pel-anggan dan memberikan keuntungan kepada pihak lain, maka pemberian informasi rahasia menurut keperluan-nyaharusmelaluipersetujuanDireksi.
Perusahaan juga bekerja dengan data khusus milik pelanggan, rekanan, dan mitra usaha. Hal ini mer-upakan kepercayaan yang sangat penting dan harus mendapatkan perhatian utama dari Perusahaan untuk menghargai kerjasama yang berkelanjutan dari pelang-gan, rekanan, dan mitra usaha lainnya. Oleh karena itu tidak seorangpun boleh mengungkapkan informasi rahasia tersebut kepada pihak luar tanpa persetujuan DireksiataupejabatyangditunjukolehDireksi,atautidak seorangpun boleh mengungkapkan informasi ra-hasia tersebut kepada yang lain kecuali berdasarkan kebutuhan kedinasan seperlunya.
Keterbukaan Informasi
Perusahaan telah mengungkapkan informasi penting dalam Laporan Tahunan dan Laporan Keuangannya kepada Pemegang Saham dan instansi Pemerintah yang terkait sesuai dengan peraturan perundang-undangan yang berlaku secara tepat waktu, akurat, jelas dan objektif.
company’s operation within tolerance limits allowed by law.
Company Data and Information Confidentiality
Accurate and reliable records about company's busi-ness and operational activities has been maintained all times. Any payment of money, transfer of ownership, the completion of delivery services and other transac-tions should be reflected in full and in detail on ac-counting system and business records of the Company. All parties must disclose all relevant information and fully cooperate with internal and external auditors in compliance audit process or other investigation.
Company policy also prohibits Board of Commission-ers, Directors and employees to disclose confidential information concerning the Company or its customers to third parties, both inside and outside the company. Considering that the disclosure of such confidential in-formation could harm the Company or its customers and provide benefits to other parties, then the provi-sion of confidential information should get the approv-al from Board of Directors.
The company also works with special data of custom-ers, suppliers and business partners. This is a very im-portant trust and must receive primary attention from the company to appreciate the continuing cooperation of customers, suppliers and other business partners. Therefore, no person may disclose confidential infor-mation to outside parties without approval of Direc-torsorofficersappointedbyBoardofDirectors,ornoperson may disclose confidential information to others except as necessary based on service needs.
Information Disclosure
The Company has revealed important information in annual report and financial report to shareholders and relevant government agencies in accordance with applicable laws and regulations in timely, accurate, clearandobjective.
![Page 94: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/94.jpg)
Annual Report 2011 Laporan Tahunan
94PT Biro Klasifikasi Indonesia (Persero)
Perusahaan menyampaikan informasi kepada khalayak umum, antara lain, melalui Website, Customer Meet-ing, Pertemuan Komite Konsultansi Klasifikasi Indo-nesia (K3I), Presentasi, BUMN online, Brosur, Com-pany Profile, Annual Report dan Promosi di sejumlah media massa.
Karyawan dan Hubungan Industrial
Perusahaan telah mengembangkan kualitas sumber daya manusianya, sesuai dengan kebutuhan, visi dan misi, serta program jangka panjang Perusahaan.
Perusahaan mempunyai unit bisnis yang beroperasi di berbagai daerah dengan agama, budaya, tradisi, adat istiadat, kondisi karyawan serta peraturan setempat yang berbeda-beda. Meskipun peka terhadap perbedaan tersebut, Perusahaan tetap menerapkan prinsip-prinsip yangdidasarkanpadaketentuanGCG.Direksimemper-lakukan pegawai secara adil dan bebas dari bias karena perbedaan suku, asal-usul, kelompok, jenis kelamin, agama dan asal kelahiran serta hal-hal yang tidak terkait dengan kinerja dan indikator lain yang bersifat objektif. Perusahaan telah menetapkan beberapa kebijakan men-genai pegawai dan hubungan industrial, antara lain :• Memberikan kondisi kerja yang baik dan aman
bagi pegawai.• Melindungi pegawai dari segala bentuk kemungki-
nan yang membahayakan keselamatan dan keseha-tan di tempat kerja.
• Memberikan hak kepada pegawai untuk berkumpul dan berserikat sesuai peraturan perundangan yang berlaku.
• Memberikan kesempatan kepada pegawai untuk mengikuti pendidikan, pelatihan, dan pengem-bangan diri lebih lanjut yang sejalan dengan kompe-tensi yang bersangkutan serta sesuai dengan kebu-tuhan Perusahaan baik saat ini maupun pada masa yang akan datang.
• Mengusahakan agar skema remunerasi yang dit-erima pegawai, secara umum mengikuti peraturan/ketentuan yang berlaku dan sesuai kemampuan Pe-rusahaan.
Company submitted information to public, among others, through the website (www.klasifikasiindone-sia.com), customer meetings, meetings Classification Consultancy Committee of Indonesia (K3I), presenta-tion, online State Owned Companies, brochures, com-pany profile, annual report, exhibition and promotion in a number of mass media.
Personnel and Industrial Relation
The company has developed its human resources in accordance with needs, vision and mission, and com-pany's long-term program.
The Company has business units that operate in vari-ous regions with different religion, culture, traditions, customs, employees’ condition and local regulations. Although sensitive to these differences, the Company has adopted the principles based on GCG provision. Directors treat employees fairly and free from bias due to differences in ethnicity, origin, group, sex, religion and origin of birth and matters unrelated to perfor-mance and objective other indicators.TheCompanyhas established several policies related to personnel and industrial relations, among others:
• Provided good and safety working conditions foremployees.
• Protected employees from all forms of possibilitythat endanger the safety and health in workplace.
• Gave employees a right to assemble and associa-tion in accordance with applicable legislation.
• Provideopportunitiesforemployeestoparticipatein education, training and further development in line with relevant competence and in accordance with the Company’s needs both present and future.
• Ensured that employees received remunerationschemes, generally follow the applicable rules / reg-ulations and in accordance with company’s ability.
• Provide incentives and performance bonuses toemployees based on performance.
• Board of Directors has full authority to act instrict accordance with applicable provisions and regulations to uphold GCG principles to employees who are proven to cause restlessness, violating the
![Page 95: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/95.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
95 Annual Report 2011
• Memberikan bonus dan insentif prestasi kepada pegawai sesuai kinerjanya.
• Direksimemiliki kewenanganpenuhuntukbertin-dak tegas berdasarkan ketentuan dan peraturan yang berlaku dengan menjunjung prinsip-prinsip GCG terhadap pegawai yang terbukti menimbulkan kere-sahan, melanggar norma disiplin pegawai, dan meru-sak suasana kerja yang kondusif.
Pegawai juga memiliki berbagai kewajiban yang harus dipenuhi terhadap Perusahaan. Kewajiban Pegawai ter-hadap Perusahaan antara lain:• Setiap pegawai wajib mentaati Peraturan Pokok
Kepegawaian (Perpok), Nilai-nilai Perusahaan dan semua peraturan yang dikeluarkan Perusahaan.
• Setiap pegawai wajib mendahulukan kepentingan Pe-rusahaan yang berhubungan langsung atau tidak langsung dengan tanggung jawabnya.
• Setiap pegawai wajib mengerahkan segala daya dan upaya dalam melaksanakan tugas pekerjaan yang diserahkan kepadanya.
• Setiap pegawai wajib menjaga harta milik dan nama baik Perusahaan.
• Setiap pegawai yang menjadi atasan wajib membina dan memberikan teladan pada pegawai di lingkun-gan kerjanya.
Pernyataan Palsu, Klaim Palsu, dan Konspirasi
Seluruh jajaran BKI yang berkaitan dengan tugas pe-masaran, drawing approval, pelaksanaan survey dan inspeksi, proses sertifikasi, pembuatan kontak / perjan-jian dan administrasi keuangan termasuk akuntansi, telah menyadari pentingnya membuat pernyataan yang akurat dan klaim yang benar kepada Pimpinan, Pemer-intah maupun kepada pihak lain. Hal ini mencakup se-tiap pernyataan lisan dan tertulis yang disampaikan kepada pimpinan pihak lain atau yang digunakan oleh Perusahaan. Kesengajaan menyampaikan pernyataan atau klaim yang tidak benar atau yang menyesatkan atau yang melibatkan adanya konspirasi dengan orang lain untuk merugikan pihak lain dapat mengakibatkan dikenakannya hukuman administratif, pidana, perdata bagi personil yang bersangkutan dan pihak lain yang ter-libat, termasuk mitra kerja Perusahaan dan pegawainya.
norms of discipline of employees, and damaging conducive working atmosphere.
Employeesalsohavevariousobligationsthatmustbefulfilled to the Company, among others: • EverypersonnelshallobeythePrincipalCivilSer-
vice Regulation, Company values and all regula-tions issued by the Company.
• Every personnel shall prioritize company interestwhich relates directly or indirectly with their re-sponsibilities.
• Every personnel shall mobilize all resources andefforts in implementing the job tasksentrusted tothem.
• Every personnel shallmaintain the property andgood name of the Company.
• Every personnel who became a supervisor shalldevelop and provide an example of employees in work environment.
False Statement, False Claims, and Conspiracy
Whole range of BKI related to marketing tasks, draw-ing approval, execution of survey and inspection, cer-tification process, the making of contracts / agreements and financial administration including accounting, have realized the importance of making an accurate statement, and right claim to the Chairman, Govern-ment or to any other party. This includes any verbal or written statement submitted to the other party or used by the Company. Intentionality in submitting a state-ment or claim that is untrue or misleading or which involve any conspiracy with others to harm the other party could result in administrative punishment, crim-inal, civil liability for the relevant personnel and other parties involved, including partners of the Company and its employees.
![Page 96: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/96.jpg)
Annual Report 2011 Laporan Tahunan
96PT Biro Klasifikasi Indonesia (Persero)
Benturan Kepentingan
BKI mendefinisikan benturan kepentingan sebagai situ-asiterjadinyapertentangankepentinganpribadiDewanKomisaris,Direksi,ataukaryawandengankepentinganPerusahaan. Benturan ini dapat melibatkan kepentin-gan pemakai jasa, instansi lain yang berkepentingan dengan jasa BKI, rekanan, karyawan (pensiunan, aktif, atau calon karyawan) atau bahkan anggota masyarakat di tempat Perusahaan beroperasi.
Terdapat dua prinsip utama yang telah diikuti untuk mencegah terjadinya benturan kepentingan dan imp-likasi lanjutan yang sering ditimbulkannya:• Tidak memanfaatkan jabatan untuk kepentingan
pribadi dan atau untuk kepentingan orang dan atau pihak lain yang terkait.
• Menghindari setiap aktivitas di luar dinas yangdapat berpengaruh secara negatif terhadap in-dependensi dan objektivitas pertimbangan dalam pengambilan keputusan; aktivitas dimaksud tentu-nya merupakan aktivitas yang dapat bertentangan dengan kinerja jabatan atau yang dapat merugikan citra dan reputasi Perusahaan.
Benturan Kepentingan dalam Keputusan Hasil Sur-vey / Inspeksi
BKI sebagai Perusahaan yang memprioritaskan aspek keselamatan telah menyadari bahwa hasil survey, lapo-ran, dan sertifikat yang diterbitkan mempunyai imp-likasi terhadap aspek keselamatan yang diperlukan oleh pihak-pihak yang berkepentingan, antara lain pemilik kapal, pemilik cargo, asuransi, galangan, penumpang, awak kapal, Pemerintah, dan masyarakat umum secara luas.UntukituseluruhjajaranDireksi,paraKepalaDi-visi, Kepala Satuan, Kepala Unit Produksi dan Wakilnya, Kepala Bagian, Kepala Bidang, Surveyor, Inspektor dan staf teknik Kantor Pusat selalu menjaga independensinya dalam pengambilan keputusan, memberikan rekomen-dasi, keputusan hasil survey, dan pembuatan laporan. Apabila terjadi benturan kepentingan, maka pertim-bangan aspek keselamatan adalah mutlak menjadi pri-oritas utama dengan mengacu peraturan dan regulasi yang berlaku.
Conflict of Interest
BKI defines a conflict of interest as a situation of con-flict of personal interest for commissioners, directors, or employees with company interest. This conflict can involve interest of service users, other agencies con-cerned with BKI services, partners, employees (retired, active or prospective employees), or even members of community in which it operates.
There are 2 (two) main principles that have been fol-lowed to prevent conflict of interests and are often caused further implications: • Notutilizethefunctioninofficeforpersonalben-
efit or for benefit of people and or other related party.
• Avoidanyactivityoutsideagenciesthatcaninflu-ence negatively on the independence and objec-tivity in decision-making consideration. Activity iscertainlyanactivity thatmayconflictwith jobperformance or that could harm the image and reputation of the Company.
Conflict of Interest in Survey / Inspection Deci-sion
BKI as a company that prioritizes the safety aspect has realized that the survey results, reports and certificates issued have implications for safety aspects required by parties concerned, including ship owners, cargo own-ers, insurance, shipbuilding, passengers, crew, Gov-ernment , and public. For that all Directors, Heads of Division, Head of Unit, Head of Production Unit and Deputy, Head of Department, Head of Division, Sur-veyors, Inspectors and Headquarters technical staff al-ways maintain their independence in decision making, decision recommending the survey results and prepar-ing reports. In the event of a conflict of interest, then consideration of safety absolutely becomes priority in accordance with applicable rules and regulations.
![Page 97: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/97.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
97 Annual Report 2011
Benturan Kepentingan dalam Pengadaan
DewanKomisaris,Direksi,Manajemen,danKaryawantidak boleh berpartisipasi dalam setiap kegiatan pen-gadaan yang melibatkan suatu Perusahaan dimana yang bersangkutan atau keluarga yang bersangkutan mem-punyai andil atau kepemilikan saham yang signifikan, atau mempunyai kepentingan finansial tertentu.Adapun yang dimaksud dengan berpartisipasi dalam proses pengadaan adalah:• Mengundang, memberikan persetujuan, atau
membahas pekerjaan di masa mendatang dengan kontraktor dan pemasok yang berkompetisi,yaitu setiap entitas usaha yang kemungkinan di masa mendatang dapat menjadi pesaing atau pemenang kontrak dari Perusahaan.
• Meminta atau menerima uang, pemberian/hadiah,atau hal-hal lain yang bernilai, baik secara langsung maupun tidak langsung dari kontraktor dan pe-masok yang berkompetisi.
• Berusahauntukmemperolehataumengungkapkaninformasi yang terkait dengan proses pengadaan, dan sebaliknya. Pemasok barang dan jasa/kontraktor yang diundang untuk berpartisipasi dalam proses pen-gadaan harus memenuhi persyaratan menghindari benturan kepentingan yang sama sebagaimana yang diberlakukanpadaKomisaris,Direksi,Manajemendan karyawan Perusahaan.
Benturan Kepentingan dengan Aktivitas Sampingan
DewanKomisaris,Direksi,Manajemen, dankaryawandapat diizinkan melakukan aktivitas lain di luar jam kerja yang telah ditetapkan, dengan syarat bahwa ak-tivitas tersebut tidak menimbulkan benturan kepentin-gan dengan kepentingan Perusahaan dan atau aktivitas tersebut tidak menurunkan kemampuan untuk memen-uhi tugas yang telah diamanatkan. Keterlibatan dalam aktivitas lain di luar Perusahaan tidak boleh mengurangi independensi dan objektivitas dalam mengambil kepu-tusan atau mempengaruhi efektivitas dan ketepatan wak-tu penyelesaian pekerjaan karyawan yang bersangkutan. Setiap karyawan harus menjunjung tinggi standar kin-erja tanpa terkecuali dan sedapat mungkin bertindak objektif dan independen dalam setiap kegiatan sehari-hari.ApabilakemudianDireksidanataukaryawanPe-
Conflict of Interest in Goods Procurement
Board of Commissioners, Directors, Management and Employeesmust not participate in any procurementactivity involving the company where the individual or family concerned have an interest or significant share ownership or has certain financial interest. As it meant by participating in procurement process are: • Invite,giveapprovalordiscussfutureemployment
with contractors and suppliers who compete, which is any business entity which that in the future can be a competitor or winning a contract from the company.
• Solicit or accept money, gift or other things ofvalue, either directly or indirectly from competing contractors and suppliers.
• Trytoobtainordiscloseinformationrelatedtotheprocurement process and vice versa. Suppliers of goods and services (contractors) who are invited to participate in the procurement process must meet the requirements to avoid conflicts of similar in-terest as that imposed on Board of Commissioners, Directors, management and employees.
Conflict of Interest by Side Activity
Board of Commissioners, Directors, management and employees may be allowed to do other activities out-side working hours determined by the requirement that such activities do not cause conflict of interests with company interest and / or the activity does not reduce the ability to fulfill the tasks that have been mandated. Involvement in other activities outside the Companymaynotreducetheindependenceandobjec-tivity in making decision or influence the effectiveness and timeliness of work completion of those employees. Eachpersonnelmustupholdthestandardsofperfor-mance, without exception, and wherever possible to actobjectivelyandindependentlyineachoftheirdailyactivities. If then the Directors and / or employees of the company felt the possibility of conflict of interest
![Page 98: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/98.jpg)
Annual Report 2011 Laporan Tahunan
98PT Biro Klasifikasi Indonesia (Persero)
rusahaan merasakan kemungkinan timbulnya benturan kepentingan dalam kegiatan yang dilaksanakan, maka yang bersangkutan wajib memberitahukan hal tersebut secara tertulis kepada Direksi. Permohonan izin untukmelakukan aktivitas sampingan harus disampaikan dan mendapatkan persetujuan dari Pejabat yang berwenang yang ditunjuk sebelum karyawan yang bersangkutan menjalankan pekerjaan sampingan tersebut atau melaku-kan kegiatan konsultansi selepas kerja apabila terjadi salah satu atau lebih dari beberapa hal-hal berikut:• Terdapatkemungkinanbenturankepentingan.• Aktivitas luar dinas tersebut merupakan hasil
pengetahuan yang diperoleh baik secara langsung maupun tidak langsung dengan pekerjaan di Perusa-haan.
• Aktivitas luar dinas tersebut merupakan aktivitasyang tumpang tindih dengan hari dan jam kerja Pe-rusahaan.
• Aktivitas tersebut melebihi enam jam kerja padasuatu hari kerja tertentu atau lebih dari 20 jam kerja pada minggu kerja tertentu.
• Dapat mengganggu kepentingan Perusahaan danatau tugas dan tanggung jawab pokok karyawan yang bersangkutan.
Penyelewengan, Penyimpangan dan Sejenisnya
Perusahaan telah menetapkan kebijakan untuk melarang setiap bentuk penyelewengan dan penyimpangan serta senantiasa menerapkan prosedur yang wajib ditaati dan diikuti berkaitan dengan temuan, pengakuan, pelapo-ran, penyelidikan, dan penyidikan terhadap kecurigaan adanya penyelewengan dan penyimpangan.
Penyelewengan dan penyimpangan yang dimaksud ada-lah:• PelanggaranterhadapperaturanPerusahaan.• Melakukan ketidak-jujuran atau kebohongan
berkaitan dengan pelaksanaan tugas pekerjaan.• Melakukanpenggelapan,penghilangan,ataupemind-
ahtanganan segala sesuatu yang dapat merugikan Pe-rusahaan secara langsung maupun tidak langsung.
• MelakukanpemalsuanataumanipulasisuratberhargaPerusahaan seperti cek, giro, sertifikat, dan lain-lain.
• MenyalahgunakanassetPerusahaan.• Melakukan pengalihan kas, surat berharga atau as-
in activities conducted, then the concerned shall no-tify it in writing to Board of Directors. The allowance to perform sideline activities must be submitted and approved by appointed authorized officer before therelevant employees run jobsor consultancyactivitiesafter work in the event of one or more of the following: • Thereisapossibilityofconflictofinterest.• Theactivitiesoutsidethecompanycomefromthe
knowledge gained both directly and indirectly with the work within the company.
• Outside activities are activities that overlapwithcompany working hours.
• Suchactivities exceed6 (six) hours ofwork onaparticular workday or more than 20 (twenty) hours of work on a particular work week.
• Mayinterferethecompanyinterestand/ordutiesand responsibilities of those employees.
Fraud, irregularities and kinds
The Company has established a policy to prohibit any form of fraud and irregularities and continue to implement procedures that must be obeyed and followed related to finding, recognition, reporting, inquiry and investigation on suspicion of fraud and irregularities.
Fraud and irregularities referred are: • Theviolationofcompanyrules.• Conductofdishonestyordeceitrelatedtojobdu-
ties. • Conduct fraud, omission, or alienation of every-
thing that could hurt the company directly or indi-rectly.
• Conductfraudormanipulationofcompany’ssecu-rities such as checks, demand deposits, certificates and others.
• Abuseofcompanyassets.• Transfer cash, securitiesorassetsof the company
![Page 99: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/99.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
99 Annual Report 2011
set Perusahaan untuk penggunaan atau keuntungan pribadi.
• Melakukan penanganan dan pelaporan transaksibisnis dan keuangan Perusahaan yang tidak sesuai prosedur dan peraturan yang berlaku.
• Melakukanpemalsuanatas catatanakuntansiPeru-sahaan atau laporan keuangan untuk kepentingan pribadi atau kepentingan lain yang merugikan Peru-sahaan baik langsung maupun tidak langsung.
for personal use or interest.• Conduct the handling and reporting of business
and financial transaction of the company that do not comply with the procedures and regulations.
• Perform falsification of accounting records orCompany’s financial statement for personal inter-ests or other interests that can harm the company either directly or indirectly.
![Page 100: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/100.jpg)
Annual Report 2011 Laporan Tahunan
100PT Biro Klasifikasi Indonesia (Persero)
Kinerja KeuanganFinancial Performance
Laporan keuangan konsolidasi BKI yang telah diaudit dalam Laporan Tahunan ini disusun berdasarkan standar akuntansi yang berlaku umum di Indonesia.
Laba Rugi
RevenuePendapatan Usaha perusahaan pada tahun 2011men-galami pertumbuhan sebesar 18,73% dibandingkandengan tahun2010.Kontribusi terhadappertumbuhanpendapatan usaha berasal dari pertumbuhan pendapa-tansegmenKlasifikasi&Statutoriasebesar19,74%danpendapatan segmen Konsultansi & Supervisi sebesar 16,96%.Pendapatannettotahun2011sebesarRp334,085milyaratau2,94%dibawahanggarannyaRp344,210milyar.
Beban UsahaRealisasi beban usaha tahun 2011 sebesar Rp 267,297milyar atau 4,19% di bawah anggarannya sebesar Rp278,989 milyar dan mengalami pertumbuhan sebesar13,98%dibandingkantahun2010.
Laba UsahaRealisasilabausahamencapaiRp66.788milyar(2,40%)dihadapkandengananggarannyasebesarRp65,221mil-yar. Pertumbuhan laba usaha perusahaan pada tahun 2011mencapai 39,99% dibandingkan laba usaha padatahun2010.SehinggalababersihsetelahpajakmencapaiRp51,360milyaratau tumbuh41,78%dari lababersihtahun2010.
BKI consolidated financial statement already audited in this Annual Report shall be prepared based on the gener-ally applicable accountancy standards in Indonesia.
Profit Loss
RevenueThecompany'soperatingrevenuein2011increasesby18.73% compared to 2010. Contribution to revenuegrowth comes from Classification & Statutory segment by19.74%andConsultation&Supervisionsegmentby16.96%.Net income in 2011 amounted Rp 334.978 billion or2.68%belowitsbudgetofRp344.210billion.
Operating ExpensesRealizationofoperatingexpensesin2011isRp267.297billionor4.19%belowitsbudgetofRp278.989billionandincreasesby13.98%comparedto2010.
Operating IncomeRealization of operating income is Rp 66,788 billion(2.40%)comparedtobudgetofRp65.221billion.Theincreaseincompany'soperatingincomein2011reaches39.99%comparedto2010.Therefore,earningaftertaxreaches Rp 51.360 billion or grows 41.78% comparedto2010.
![Page 101: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/101.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
101 Annual Report 2011
Operating Ratio sebesar 80,01% atau 1,04% di bawahanggaransebesar81,05%.
Grafik :NetRevenue(2007-2011)NetProfit(2007-2011)
OperatingRatio is 80.01%or 1.04%below its budgetof81.05%.
Grafik :NetRevenue(2007-2011)NetProfit(2007-2011)
Rasio Keuangan
a. Rasio Likuiditas• Rasio lancar tahun 2011 sebesar 293,33% leb-
ih tinggi dari rasio lancar tahun 2010 sebesar325,98%.
• Rasiokastahun2011sebesar97,30%dantahun2010 sebesar 117,01%. Ini menunjukkan adapeningkatan dalam penyediaan kas untuk pem-biayaan operasional dan atau pembayaran ke-wajiban jangka pendeknya.
b. Solvabilitas TotalDebttoEquityRatiotahun2011sebesar32,98%
dan tahun 2010 sebesar 26,59%.Mengingat hutangyang ada tidak menimbulkan beban bunga (hanya hutang transaksi operasi / dagang), maka adanya hu-tang tersebut sangat mendukung dalam penyediaan modal kerja serta berpeluang meningkatkan laba pe-rusahaan.
c. Return on Investment Ratio (ROI) Return on Investment Ratio tahun 2011 sebesar
36,04%dantahun201034,94%.
Financial Ratio
a. Liquidity Ratio• Currentratiois293.33%whichhigherthancur-
rentratioin2010(325.98%).• Cash ratio is 97.30% in 2011 and 117.01% in
2010.Thisshowsthatthereisincreaseinavail-able cash for operational financing and or short term liabilities payment.
b. Solvability TotalDebt toEquityRatio in2011 is32.98%and
in2010was26.59%.Consideringthattheexistingloans do not accrue interest expense (only operat-ing / commercial transaction loans), they will really support in making working capital available and providing opportunity to increase company's in-come.
c. ReturnonInvestmentRatioin2011is36.04%andin2010is34,94%.
![Page 102: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/102.jpg)
Annual Report 2011 Laporan Tahunan
102PT Biro Klasifikasi Indonesia (Persero)
d. Aktivitas• TotalAssetTurnOver Perputaranassetpadatahun2011untukmeraih
pendapatan adalah sebesar 1,52 kali atau turun0,2kalidariTATOtahun2010sebesar1,72kali.
• CollectingPeriod Rata-rataharipencairanpiutangtahun2011se-
lama89hariatau12harilebihlambatdaritahun2010sebesar77hari.
Darirasio-rasiodiatasterlihatbahwalikuiditasPerusa-haan tahun 2011meningkat dibandingkan dengan ta-hun2010.Halinidisebabkanupayamelakukanefisiensidalam menggunakan dana untuk membiayai operasional dan investasi. Ditinjau dari solvabilitas menunjukkankondisi financial Perusahaan cukup aman dengan hu-tang-hutangnya dijamin modal sendiri serta Perusahaan mampu meningkatkan laba.
d. Activities• TotalAssetTurnOver TotalAssetTurnOverin2011is1.52,decreas-
ingfrom2009whichwas1.72.• CollectingPeriod Collectingperiodin2011is89daysor12days
slowerthanin2010whichwas77days.
From the above ratios, it seems that company's liquidity in 2011 increases compared to 2010.This result fromtheeffortstoutilizefundinmoreefficientwayforoper-ational and investment. Viewed from solvability aspect, it is considered that the financial condition of the com-panyissufficientlysafebecausethecompany'sloansareequity secured and company can increase its income.
ROA(2007-2011) TotalDebttoTotalAsset(2007-2011)DebttoEquityRatio(2007-2011)
Tingkat Kesehatan Perusahaan
Kriteria penilaian Perusahaan didasarkan pada SK Men-teriNegaraBUMNRIno.Kep-100/MBU/2002tanggal4Juni 2002. Materi yang dinilai mencakup :
a. Aspek keuanganb. Aspek operasionalc. Aspek administrasi
Company's Health Level
Criteria used to evaluate company's health level is in accordancewithDecreeofStateMinister forSOEno.Kep-100/MBU/2002dated4June2002.Thematerialsto be evaluated include :a. Financial aspectb. Operational aspectc. Administrative aspect.
![Page 103: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/103.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
103 Annual Report 2011
KeyPerformanceIndicator(KPI)year2011
Description 2007 2008 2009 2010 2011ASSETS Current Assets FixedAssets Other Assets TOTALASSETS LIABILITIES Short Term Liability Long Term Liability EquityTOTALLIABILITIES
53.76735.9231.64091.330
26.7432.23262.35491.330
58.09445.8121.821105.727
26.4663.13976.122105.727
67.33859.2991.686128.323
24.9923.957
99.373128.323
98.42966.6872.011167.127
30.1954.913132.019167.127
152.02477.5492.720
232.293
51.8275.780174.686232.293
No Indicator Formulation Weight Target Real. R/T Score KPI Score
1. Labor Productivity Revenue/Number of Workers
10 Min. 571
542 95 90 9
2. Preparation of Standard Costing Product / Service
Completion Standard Costing Production / Services
10 Maks. 6 month
6 month 100 100 10
3. Development of Rules / Regulations
Completion of the Rules / Regulations
10 Min. 5 6 100 100 10
4. Revenue Growth Operating Revenues in 2011 / Operating Revenues in 2010
15 Min. 120,00
118 99 98 14,7
5. Operating Ratio Cost of services / Operating Revenues
15 Maks. 59
58,10 102 105 15,75
6. Profit Margin (PM) Profit Before Tax / Income 15 Min. 18,80
20,50 109 123 18,38
7. Collecting Period Accounts Receivable / Net Revenue X 365 days
15 Maks. 66
89 74 51 7,65
8. The Development of SDM
Primary Education and Training Program
10 Min. 27 28 104 110 11
Weight Total 100 96,48
![Page 104: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/104.jpg)
Annual Report 2011 Laporan Tahunan
104PT Biro Klasifikasi Indonesia (Persero)
Board of CommissionerChairman : Abdul GaniCommissioner : Riyadi Widiasmoro Liliek Mayasari Avianto Muhtadi
Board of DirectorPresidentDirector : PurnamaSMTechnical&DevelopmentDirector : AjatimanOperating&MarketingDirector : S.DangkengFinance&PersonnelDirector : EdyCahyono
StaffHead of Planning Unit : Taufik Hidayat Head of Internal Control Unit : Asep SutrisnaHead of Quality Assurance Unit : Bambang Tri Suharto HeadofR&DUnit : SaifuddinWijaya
Technical StaffHeadofSurveyDivision : ZilzalHMHeadofStatutoryDivision : JoeliantoroHeadofMachinery&ElectricalDivision : AgusWidjajaHeadofHull&MaterialDivision : HadiSoetrisnoHeadofC&SDivision : ArsalnanLatiefHeadofClassAdmissionDept. : RahmadiHeadofClassMaintenanceDept. : HeintjeAngganoisHeadofMonitoring&RegisterDept. : AgungWicaksonoHeadofSolas&MarpolDept. : AriefBudiPermanaHeadofLoadLine&CargoGearDept. : EryDaniSampurnoHeadofMachineryDept. : SugengYuliantoHeadofElectricalDept. : AgusSalimHead of Industrial Service : Salvinus PatangkeHeadofHullDept. : SunaryokoHeadofWelding&MaterialDept. : RomyLesmanaHeadofC&SMarketingDept. : HerrySudrajatHeadofControlofC&SProd.Dept : AgungPrihanto
Dewan Komisaris, Direksi dan StafBoard of Commissioner, Director and Staff
![Page 105: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/105.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
105 Annual Report 2011
Administration StaffHeadofFinanceDivision : HermanYuskaHeadofPersonnel&GADivision : PriyoSantosaHeadofAccountingDept. : R.SudaryoHeadofFinancialAdm.Dept. : RisaAfrianaR.HeadofPersonnel&TrainingDept. : NasaruddinHeadofGeneralAffairDept : KokoKusnadiHeadofLegal&PublicRelationsDept. : YuniatiHeadofInformationSystemDept. : DidingSuwandiHeadofProgram&BudgetingDept. : Sudirman
Branch ManagerHead of Ambon Branch Office : Sigit PrastowoHead of Balikpapan Branch Office : Pardy AbbasHeadofBanjarmasinBranchOffice : FaridRahmanRahimHeadofBelawanBranchOffice : RidwanDjajantoHead of Batam Branch Office : Nurdin GadingHeadofBitungBranchOffice : DoniTriSusiloHeadofC&SUnit : YansenMiriHeadofCigadingBranchOffice : EndroDjokoSaputroHeadofCirebonBranchOffice : ManggarsetaDjatnikaHeadofDumaiBranchOffice : AndiSolihinRizalHead of Jambi Branch Office : Benni HermawanHead of Makassar Branch Office : Syarif Nuhung Head of Palembang Branch Office : Syamsul BahriHead of Pontianak Branch Office : AzharHead of Pekanbaru Branch Office : Rusdin Halludin Head of Semarang Branch Office : Alfonsus SusilarsoHead of Singapore Branch Office : Arief NurtjahyoHead of Sorong Branch Office : Misbahudin AidyHead of Surabaya Branch Office : I Nyoman Gde ArimbawaHead of Tanjung Priok Branch Office : Mohammad Cholil
![Page 106: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/106.jpg)
Annual Report 2011 Laporan Tahunan
106PT Biro Klasifikasi Indonesia (Persero)
Jaringan OperasionalOperation Network
Belawan
Dumai
Pekanbaru
Jambi
Palembang
Singapore
Batam
Cigading
Jakarta
Cirebon
Semarang
Surabaya
Pontianak
Banjarmasin
Balikpapan
Makassar
Bitung
Ambon
Sorong
![Page 107: daftar isi - bki.co.id · SNI 19-17020 (akreditasi perusahaan jasa inspeksi teknik) dan SNI 19-17025 (akreditasi laboratori-um). • Training for technical expertise.](https://reader034.fdocument.pub/reader034/viewer/2022052205/5c80f4c709d3f2c3348bbb31/html5/thumbnails/107.jpg)
PT Biro Klasi f ikasi Indonesia (Persero)
107 Annual Report 2011
Daftar KontakList of Contact
AmbonJl. Raya Pelabuhan, Komplek Pelabuhan, Ambon 97216Telephone. (0911) 349607Facsimile. (0911) 352745E-mail : [email protected]
BalikpapanJl. MT. Haryono No. 8 Ring Road Balikpapan 76111Telephone. (0542) 876637, 876641, 876642, 876643Facsimile. (0542) 876639, 876645E-mail : [email protected]
BanjarmasinJl. Skip Lama No. 19 Banjarmasin 70117Telephone. (0511) 3350175, 3358311, 3350893Facsimile. (0511) 3350175E-mail : [email protected]
BatamGraha BKI Jl. Yos Sudarso Kav. 5, Batam 29421Telephone. (0778) 433388, 429023-24, 451288Facsimile. (0778) 429020, 429021E-mail : [email protected]
BelawanJl. Veteran No. 218, Belawan 20411Telephone. (061) 6941025, 6941276, 6941157Facsimile. (061) 6941276E-mail : [email protected]
BitungJl. Babe Palar No. 53, Madidir Unet, Bitung 95516Telephone. (0438) 38720, 38721Facsimile. (0438) 21282E-mail : [email protected]
CigadingJl. Gerem Raya No. 1 KM 5, Pulau Merak, Cilegon 42438Telephone. (0254) 573955, 573417Facsimile. (0254) 571007E-mail : [email protected]
CirebonJl. Tuparev KM 3, Cirebon 45153Telephone. (0231) 205266Facsimile. (0231) 205266E-mail : [email protected]
DumaiJl. Arifin Ahmad No. 40 Kel. Tangkerang Tengah, Kec. Marpoyan Damai Pekanbaru 28282Telephone. (0761) 7662160, 7662170Facsimile. (0761) 7662180E-mail : [email protected]
Jambi Jl. Raden Bahrun No. 11 RT 11 RW 04 Kel. Sungai Putri, Kec. Telanai Putra JambiTelephone. (0741) 671107Facsimile. (0741) 671108E-mail : [email protected]
MakassarJl. Sungai Cerekang No. 28 Makassar 90115Telephone. (0411) 311993, 315460Facsimile. (0411) 315460E-mail : [email protected]
PalembangJl. Perintis Kemerdekaan, 5 Ilir, Palembang 30115Telephone. (0711) 713171, 717151, 713712, 713680Facsimile. (0711) 713173E-mail : [email protected]
PekanbaruJl. Arifin Ahmad No. 40 Kel. Tangkerang Tengah Kec. Marpoyan Damai Pekanbaru 28282Telephone. (0761) 7662160, 7662170Facsimile. (0761) 7662180E-mail : [email protected]
PontianakJl. Gusti Hamzah No. 211, Pontianak 78116Telephone. (0561) 739579, 743107Facsimile. (0561) 739579, 743107E-mail : [email protected]
SemarangJl. Pamularsih No. 12 Semarang 50148Telephone. (024) 7610399, 7610744Facsimile. (024) 7610422E-mail : [email protected]
Singapore150 Changi Road #02-01 Aguthrie building – Sin-gaporeTelephone. (065) 68830651, 68830643, 68830634Facsimile. (065) 63393631E-mail : [email protected]
SurabayaJl. Kalianget No. 14, Surabaya 60165Telephone. (031) 3295448, 3295449, 3295450, 3295451, 3295465Facsimile. (031) 3294520, 3205451E-mail : [email protected]
SorongJl. Jenderal Sudirman No. 140, Sorong 98414Telephone. (0951) 322600Facsimile. (0951) 323870E-mail : [email protected]
Tanjung PriokJl. Yos Sudarso 38-39-40, Tanjung Priok, Jakarta 14320Telephone. (021) 4301017-18-19, 4301703, 4300993, 4353291-92, 43933021Facsimile. (021) 4301702, 497020E-mail : [email protected]
Unit Konsultansi & SupervisiJl. Yos Sudarso 38-39-40, Tanjung Priok, Jakarta 14320Telephone. (021) 4301017-18-19, 4301703, 4300993, 4353291Facsimile . (021) 43900972, 4300139E-mail : [email protected]