© Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y...
-
Upload
maria-cristina-lopez-juarez -
Category
Documents
-
view
214 -
download
1
Transcript of © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y...
![Page 1: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/1.jpg)
© Copyright Ebiointel,SL 2006
Motivos, estructura
y funciónProf. Inma Ponte
Motivos, estructura
y funciónProf. Inma Ponte
![Page 2: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/2.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: Objetivos
•Análisis de la secuencia de aa de una proteína•alineamiento con proteínas homólogas•búsqueda de zonas conservadas
•Predecir la presencia de estructuras secundarias
•Analizar la presencia de motivos
![Page 3: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/3.jpg)
© Copyright Ebiointel,SL 2006
Posibles estructuras secundariasPosibles estructuras secundarias
• Hélice
alfa
• Hoja beta • Giro beta
•Random
coil
Motivos y estructuras: estructura secundaria
![Page 4: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/4.jpg)
© Copyright Ebiointel,SL 2006
• Método estadístico basado en estructuras cristalográficas ya resueltas • Calcula un parámetro conformacional para cada residuo de la proteína • Este parámetro refleja la preferencia de este residuo en hallarse en un tipo de estructura determinado• Inicialmente se basaron en 15 proteínas, después en 24 y finalmente en 64• Cuatro grupos de proteínas: alfa, beta, alfa+beta, alfa/beta
Limitaciones: no se puede usar con proteínas muy distintas a las 64 proteínas con la estructura conocida en que se basa este método
CHOU-FASMAN
Motivos y estructuras: métodos de predicción
![Page 5: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/5.jpg)
© Copyright Ebiointel,SL 2006
-Método estadístico basado en tres pasos:
predicción de la clase de proteína (según comp. Aa)
predicción de la estructura secundaria (frecuencia de cada residuo) nueva predicción optimizando parámetros
Limitaciones:si la predicción de la clase de proteína es correcto, la predicción de estructura secundaria es más acertada que en los otros métodos. Si la proteína no queda bien clasificada, la predicción no es fiable.
DELEAGE&ROUX
Motivos y estructuras: métodos de predicción
![Page 6: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/6.jpg)
© Copyright Ebiointel,SL 2006
-Método estadístico basado en estructuras cristalográficas ya resueltas (25)
-No sólo tiene encuenta la preferencia de un aa por una estructura, sino que además considera el entorno de este aa (ventana de 16 aa)
-Fundamentalmente se basa en los ángulos f y y del enlace peptídico y en los puentes de hidrógeno de las estructuras secundarias.
Limitaciones:la proteína problema no debe diferir substancialmente de las 25 proteínas de estructura conocida.
GARNIER-ROBSON
Motivos y estructuras: métodos de predicción
![Page 7: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/7.jpg)
© Copyright Ebiointel,SL 2006
-Karplus flexibility
Perfiles de probabilidad de encontrase en la superfície de la proteína
Perfiles de hidroafinidad (hidrofobicidad/hidrofilicidad)
Perfiles de flexibilidad. (flexibilidad de la cadena peptídica)
-Eisemberg moment
-Kyte-Doolitte
-Emini surface probability
Perfiles de densidad de carga
-Charge density
Motivos y estructuras: métodos de predicción
![Page 8: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/8.jpg)
© Copyright Ebiointel,SL 2006
-Karplus flexibility
Perfiles de probabilidad de encontrase en la superfície de la proteína
Perfiles de hidroafinidad (hidrofobicidad/hidrofilicidad)
Perfiles de flexibilidad. (flexibilidad de la cadena peptídica)
-Eisemberg moment
-Kyte-Doolitte
-Emini surface probability
Perfiles de densidad de carga
-Charge density
Motivos y estructuras: métodos de predicción
![Page 9: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/9.jpg)
© Copyright Ebiointel,SL 2006
http://us.expasy.org
http://npsa-pbil.ibcp.fr/http://npsa-pbil.ibcp.fr/•http://bmerc-www.bu.edu/
•http://cubic.bioc.columbia.edu/predictprotein/
Motivos y estructuras: métodos de predicción
![Page 10: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/10.jpg)
© Copyright Ebiointel,SL 2006
• Se basa en la consideración de que la estructura que adoptan los aa que flanquean un determinado aa central determinan la estructura que adapta este aa central.
• El método estudia los 8 aa N-terminales y los 8 aa C-terminal. Establece tres o cuatro (GOR III /GOR IV) matrices: una cuando el aa central es alfa, otra para beta, otro para random, y otra turn.
•Usa información teórica para la decisión final.
GOR – METHOD (Garnier, Ousguthorpe and Robson)
Motivos y estructuras: métodos de predicción
![Page 11: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/11.jpg)
© Copyright Ebiointel,SL 2006
Neural Networks Models
Estos métodos contemplan tres niveles:
•El primer nivel: la preedición se realiza sobre alineamientos múltiples• El segundo nivel: se consideran los elementos de estructura secundaria en las proteínas homologa •El tercer nivel: promediar las predicciones obtenidas independientemente.
Motivos y estructuras: métodos de predicción
![Page 12: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/12.jpg)
© Copyright Ebiointel,SL 2006
PSA – METHOD (Protein Sequence Analysis)
•Este método predice la estructura secundaria de proteínas sin homología de secuencia y sin homología de estructura.
•Se basa en 15 modelos matemáticos. Se han establecido tres o cuatro superclases. Los modelos matemáticos establecen las restricciones de cada tipo de estructura alfa, beta, etc.. en cada superclase.
Motivos y estructuras: Interpro
![Page 13: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/13.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: Interpro
![Page 14: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/14.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: métodos de predicción
![Page 15: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/15.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: Interpro
![Page 16: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/16.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: Interpro
![Page 17: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/17.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: Interpro
![Page 18: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/18.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: Interpro
![Page 19: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/19.jpg)
© Copyright Ebiointel,SL 2006
•Muchas proteínas tienen estructura «modular»•Estimación: ~ 3 dominios / proteína•Dominios (secuencias o estructuras conservadas) identificadas por alineamiento múltiple de secuencia
Dominio/motivo/patron
• Patrones (expresión regular); usado en dominios muy conservados
•Perfiles (matrices de pesos): tablas de dos dimensiones por posición específicos para match-, gap-, y insertion, derivados del alineamiento
de secuencia de la familia, usado para dominios menos conservados
•Hidden Markov Model (HMM); modelo probabilístico.
Métodos para definir dominios
Motivos y estructuras: busqueda de motivos
![Page 20: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/20.jpg)
© Copyright Ebiointel,SL 2006
Bancos de datos de motivos/familia
PROSITE Patrones / Perfiles
ProDom Alineado de motivos (PSI-BLAST) (Pfam B)
PRINTS Alineado de motivos
Pfam HMM (Hidden Markov Models)
SMART HMM
TIGRfam HMM
DOMO Alineado de motivos
BLOCKS Alineado de motivos (PSI-BLAST)
CDD(CDART) PSI-BLAST(PSSM) de Pfam y SMART
Motivos y estructuras: busqueda de motivos
![Page 21: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/21.jpg)
© Copyright Ebiointel,SL 2006
http://us.expasy.org/prosite/
•consiste en patrones y perfiles significativos biológicamente
•ayudar a determinar a que familia de proteínas pertenece la secuencia.
Motivos y estructuras: busqueda de motivos
![Page 22: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/22.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: busqueda de motivos
Generar Patrón Prosite
• G-H-E-x(2)-G-x(5)-[GA]-x(3)
![Page 23: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/23.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: busqueda de motivos
Ejemplo Patrón PrositeEjemplo Patrón Prosite
<A-x-[ST](2)-x(3,5)-{V}
•< N-terminal
•x cualquier aa
•[ST] serina o treonina dos veces
•x(3,5) cualquier aa de 3 a 5 veces
•{V} cualquier aa excepto valina
![Page 24: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/24.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: busqueda de motivos
Patrón Prosite
•Http://www.expasy.org/prosite/
![Page 25: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/25.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: busqueda de motivos
Patrón Prosite
. Ventajas: . Rápido y fácil de implementar. . Los modelos son fáciles de comprender.
. Limitaciones:
. Pobre tratamiento de las inserciones/delecciones.
. Cuando los patrones son pequeños da muchos falsos positivos. . Los patrones largos son difíciles de ajustar al modelo. . No nos proporciona un score, está o no está.
. ¿Cuándo usar los patrones?
. Para usar motivos pequeños o centros activos.
. Para describir un motivo de forma sencilla.
![Page 26: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/26.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: busqueda de motivos
Perfil PrositePerfil Prosite
![Page 27: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/27.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: busqueda de motivos
Perfil PrositePerfil Prosite
![Page 28: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/28.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: busqueda de motivos
Perfil PrositePerfil Prosite
![Page 29: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/29.jpg)
© Copyright Ebiointel,SL 2006
Motivos y estructuras: busqueda de motivos
Perfil PrositePerfil Prosite
. Ventajas:. Podemos especificar cuando ocurren inserciones odelecciones.. Nos proporciona un score.. Se puede construir automáticamente.
. Limitaciones:. Muy caro en tiempo de CPU.. El software es más sofisticado.. La lectura del patrón no es intuitiva.
![Page 30: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/30.jpg)
© Copyright Ebiointel,SL 2006
InterPro
www.ebi.ac.uk/interpro
Motivos y estructuras: Interpro
InterPro integra:InterPro integra:
• Pfam• PROSITE• ProDom• SMART• TIGRFAMs
![Page 31: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/31.jpg)
© Copyright Ebiointel,SL 2006
InterPro
www.ebi.ac.uk/interpro
Motivos y estructuras: Interpro
![Page 32: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/32.jpg)
© Copyright Ebiointel,SL 2006
Ejercicio 1Ejercicio 1
Determinar la predicción de estructura secundaria de Determinar la predicción de estructura secundaria de las siguientes proteínas. Utilizar diferentes métodos y las siguientes proteínas. Utilizar diferentes métodos y decidir que tipo de estructura es el mayoritario. decidir que tipo de estructura es el mayoritario.
Que proteasa utilitarias para aislar el C-terminal Que proteasa utilitarias para aislar el C-terminal (aprox 100 últimos aa) de la histona H10. Te serviría (aprox 100 últimos aa) de la histona H10. Te serviría esta misma proteasa para los otros subtiposesta misma proteasa para los otros subtipos
El C-terminal de esta proteína tiene putativos sitios El C-terminal de esta proteína tiene putativos sitios de fosforilacions para la CK2 y para la PKC.de fosforilacions para la CK2 y para la PKC.
![Page 33: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/33.jpg)
© Copyright Ebiointel,SL 2006
SecuenciasSecuencias::
H10, H10, TENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK KPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
H12 H12 SETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKESETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSRSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKKAAGGATPKKSAKKTPFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKKAAGGATPKKSAKKTPKKAKKPAAATVTKKVAKSPKKAKVAKPKKAAKSAAKAVKPKAAKPKVVKPKKKKAKKPAAATVTKKVAKSPKKAKVAKPKKAAKSAAKAVKPKAAKPKVVKPKKAAPKKK AAPKKK
H13 H13 SETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKESETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSRSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKKKVTKAKKAAPKKK
![Page 34: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/34.jpg)
© Copyright Ebiointel,SL 2006
Ejercicio 2
Para una proteína dada (ejemplo TDF humana):
• ¿Cómo saber si contiene dominios funcionales?
•¿Qué otras proteínas contienen ese mismo dominio funcional?
![Page 35: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/35.jpg)
© Copyright Ebiointel,SL 2006
Ejercico 3:Ejercico 3:
Has realizaHas realizado do un protocoloun protocolooo de purificación de purificaciónnn de de la prothymosin alfa humana (Q15200). la prothymosin alfa humana (Q15200). En lugar En lugar de obtenerde obtener una sola proteína, o una sola proteína, obbtitienes enes tres, tres, con con las siguientes características:las siguientes características:
proteína 1 Mr: 16000 pI: 7 proteína 1 Mr: 16000 pI: 7 proteína 2 Mr: 12000 pI: 3.7 proteína 2 Mr: 12000 pI: 3.7 proteina 3 Mr: 11000 pI: 6 proteina 3 Mr: 11000 pI: 6
Cual de ellas es la correcta, Cual de ellas es la correcta,
Que estrategia puedes utilizar para comprobar Que estrategia puedes utilizar para comprobar que realmente esta es tu proteína.que realmente esta es tu proteína.
![Page 36: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/36.jpg)
© Copyright Ebiointel,SL 2006
•Ejercicio 4:
El domino globular de la histona H5 (1Hst) se ha resuelto por cristalografía. Quieres estudiar la estabilidad de la primera hélice alfa. Que aproximación puedes seguir.
![Page 37: © Copyright Ebiointel,SL 2006 Motivos, estructura y función Prof. Inma Ponte Motivos, estructura y función Prof. Inma Ponte.](https://reader035.fdocument.pub/reader035/viewer/2022062808/5665b4ef1a28abb57c94e5a5/html5/thumbnails/37.jpg)
© Copyright Ebiointel,SL 2006
•Ejercicio 5: Construir un PatrónConstruir un Patrón